Geobacillus sp. WCH70: GWCH70_0073 Help Entry GWCH70_0073       CDS       T00915                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gwc  Geobacillus sp. WCH70 Pathway gwc00790   Folate biosynthesis gwc01100   Metabolic pathways gwc01240   Biosynthesis of cofactors Module gwc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gwc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GWCH70_0073 Enzymes [BR:gwc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GWCH70_0073  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GWCH70_0073  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GWCH70_0073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ACS23014 UniProt:  C5D398 LinkDB All DBs Position 86024..86404 Genome browser AA seq 126 aa AA seqDB search MEKEWRAIDKIYLHRMEFYGYHGVLPEENVLGQRFIVDVILETDLQKAGKSDRLDDTINY AEVYDICRNVVEKRRFALIEAVAETIAEQILSSFPTVARCTIKVTKPNPPIQGHYESVAV EIVRGR NT seq 381 nt NT seq  +upstreamnt  +downstreamnt ttggaaaaggagtggagagcgatcgataaaatttatcttcatcggatggagttttatgga tatcacggcgtccttcccgaagaaaatgtgcttggacagcgctttattgtagatgtcatt ctcgaaacggatttacaaaaggctggaaaaagcgatcgattagatgataccattaattat gcggaagtgtacgatatttgccgaaatgttgtcgagaaaaggagatttgcgttaatcgaa gcagtagcagagacgattgcggagcaaattttatcttcttttccaaccgttgctcgttgt acgattaaagtgacaaaaccaaatccacccattcaaggtcattatgaatctgtagcagta gaaattgtaaggggtcgttag

DBGET integrated database retrieval system