Geobacillus sp. Y412MC52: GYMC52_0070 Help Entry GYMC52_0070       CDS       T01399                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gya  Geobacillus sp. Y412MC52 Pathway gya00790   Folate biosynthesis gya01100   Metabolic pathways gya01240   Biosynthesis of cofactors Module gya_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gya00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GYMC52_0070 Enzymes [BR:gya01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GYMC52_0070  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GYMC52_0070  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GYMC52_0070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CclA_1 Motif Other DBs NCBI-ProteinID:  ADU92585 UniProt:  A0A0E0T7C5 LinkDB All DBs Position 84163..84543 Genome browser AA seq 126 aa AA seqDB search MGRERAVIDKICVQGMEFYGYHGVFREENILGQRFLVDVTLELDLQPAGRSDCLEYTVNY ADVYERCRAIVEERTFALIEAVAEAIAADLLAAFPVVERCIVKVTKPNPPIRGHYQHVAV EIDRGR NT seq 381 nt NT seq  +upstreamnt  +downstreamnt ttgggaagggagagagcggtcatcgataaaatttgtgtgcaaggcatggagttttacggc taccacggcgtgtttcgcgaagaaaacatcctcggccagcgatttttggttgatgtgacg ttggagctcgacttgcagcccgccgggcggagcgattgtcttgagtataccgtcaactac gccgatgtgtacgagcgctgccgggcgatcgttgaggagcggacgttcgccttgatcgag gcggtcgctgaagcgatcgccgccgacttgctcgctgcctttcctgttgtcgagcgctgc attgtcaaagtgacgaagccgaatccgccgattcgcggccattatcaacatgtcgcagtc gaaattgataggggtcgttaa

DBGET integrated database retrieval system