Hahella sp. KA22: ENC22_13305 Help Entry ENC22_13305       CDS       T05793                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism hahe  Hahella sp. KA22 Pathway hahe00261   Monobactam biosynthesis hahe01100   Metabolic pathways hahe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hahe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ENC22_13305  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hahe01008]     ENC22_13305 Polyketide biosynthesis proteins [BR:hahe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ENC22_13305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZZ92124 UniProt:  A0A3T0VLN3 LinkDB All DBs Position 2980709..2980930 Genome browser AA seq 73 aa AA seqDB search MNTEQLNPFDDESLPFLVLINSRGQYSLWPQFTSIPPGWRNVLGPARRAECLHYIEQNWT DIRPRLSIDPADK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaatacagaacagctcaacccattcgacgacgaatccttgccatttctggtgctgatc aacagccgcgggcaatacagtttatggccgcaattcacgtcgattccccccggttggcgc aatgtcctcggtccggccaggcgcgccgaatgtctgcactatatcgagcagaactggacc gatatccgtccccgattatcgattgatcccgctgacaagtag

DBGET integrated database retrieval system