Hahella sp. HNIBRBA332: O5O45_08455 Help Entry O5O45_08455       CDS       T09430                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism hahh  Hahella sp. HNIBRBA332 Pathway hahh00261   Monobactam biosynthesis hahh01100   Metabolic pathways hahh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hahh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     O5O45_08455  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hahh01008]     O5O45_08455 Polyketide biosynthesis proteins [BR:hahh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     O5O45_08455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WLQ15945 UniProt:  A0AA49XQU1 LinkDB All DBs Position 1809950..1810171 Genome browser AA seq 73 aa AA seqDB search MNTEQPNPFDDESLPFLVLINSRGQYSLWPQFTSIPPGWRNVLGPARRADCLHYIEQNWT DIRPRLSINPADK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaatacagagcagcccaacccgttcgatgacgaatccctgccatttctggtgctgatc aacagccgcggacaatacagtttatggccgcaattcacgtcaattccgcctggttggcgc aacgttctcggtccggccagacgcgccgactgccttcattatattgaacagaactggacc gatatccgcccccgattatctataaatccagcagataaatag

DBGET integrated database retrieval system