Halanaeroarchaeum sp. HSR-CO: HSRCO_0437 Help Entry HSRCO_0437        CDS       T09490                                  Name (GenBank) Ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hahs  Halanaeroarchaeum sp. HSR-CO Pathway hahs00020   Citrate cycle (TCA cycle) hahs00720   Carbon fixation pathways in prokaryotes hahs01100   Metabolic pathways hahs01110   Biosynthesis of secondary metabolites hahs01120   Microbial metabolism in diverse environments hahs01200   Carbon metabolism hahs01210   2-Oxocarboxylic acid metabolism Module hahs_M00009   Citrate cycle (TCA cycle, Krebs cycle) hahs_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:hahs00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HSRCO_0437   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     HSRCO_0437 Enzymes [BR:hahs01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HSRCO_0437 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_9 Fer4_2 Fer4_10 Fer4_4 Fer4_16 Fer4_18 Fer4_17 Fer4_13 Fer4_8 Fer4_15 Fer4_22 Fer4_3 Fer4_19 Motif Other DBs NCBI-ProteinID:  UWG46734 LinkDB All DBs Position 412934..413167 Genome browser AA seq 77 aa AA seqDB search MAVLEATTGEAVRISLDKQLCKGCEICVSQCPTDVFGMAGSPPERYPVVEAVDDCVDCGI CELICPDFALSVEGVDE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctgtactcgaggcgacgacgggtgaggccgtccgtatctcgctcgacaagcaactc tgtaaagggtgtgagatctgcgtctcgcagtgtccgacggacgtcttcgggatggctggc tcgccaccggagcgatatccggtcgtcgaggccgtcgacgactgcgtggactgtggcatc tgcgaactcatctgtccggatttcgcgctgtcggtggagggcgtcgatgagtga

DBGET integrated database retrieval system