Halorubrum sp. BOL3-1: EKH57_14800 Help Entry EKH57_14800       CDS       T05834                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism halb  Halorubrum sp. BOL3-1 Pathway halb00400   Phenylalanine, tyrosine and tryptophan biosynthesis halb01100   Metabolic pathways halb01110   Biosynthesis of secondary metabolites halb01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:halb00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     EKH57_14800 Enzymes [BR:halb01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      EKH57_14800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Osmo_CC Motif Other DBs NCBI-ProteinID:  QAU13885 UniProt:  A0A410TSW1 LinkDB All DBs Position complement(2853220..2853513) Genome browser AA seq 97 aa AA seqDB search MSDTPNTENRSLDELRREIEDIDREIVELIARRTYVADTVAAVKEDRDLPTTDEGQEERV MERAGENAEQFDVDANLVKAIFRLLIELNKVEQRESR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcgacacacccaacaccgagaaccggagcctcgacgaactgcgccgcgagatcgag gacatcgaccgcgagatcgtggaactgatcgcccgccgcacctacgtcgccgacacggtc gcggccgtcaaggaggaccgcgacctcccgaccaccgacgagggccaagaggagcgcgtg atggagcgggcgggcgagaacgccgagcagttcgacgtcgatgccaacctcgtgaaggcg atcttccggctgctgatcgagttgaacaaggttgagcagcgggagagccgatag

DBGET integrated database retrieval system