Halocella sp. SP3-1: D7D81_09555 Help Entry D7D81_09555       CDS       T05769                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hals  Halocella sp. SP3-1 Pathway hals00790   Folate biosynthesis hals01100   Metabolic pathways hals01240   Biosynthesis of cofactors Module hals_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hals00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     D7D81_09555 (folB) Enzymes [BR:hals01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      D7D81_09555 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      D7D81_09555 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      D7D81_09555 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AZO94819 LinkDB All DBs Position 2015322..2015702 Genome browser AA seq 126 aa AA seqDB search MDRIIIKDLQVYAYHGVAREEKINGQMFFVSLKIGADLEKAATTDNLNNTLSYTEICNTV QIILQSRKYNLIESAAMRIIEHLFRTYTNINEIWILLKKPWAPMGYHLKYAAVELERKRG DRNEWY NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggataggataattattaaggatttgcaggtatatgcttatcatggagttgcacgggaa gaaaagattaacgggcagatgttttttgtttccctgaagattggtgcggatcttgaaaaa gcagcaacaactgacaacttgaataatacactgagttataccgagatatgcaatactgtg caaataatactgcaatccaggaaatataatttgattgagtccgctgccatgagaataatt gagcatctattcaggacatatacaaatattaatgagatatggattttgttgaaaaaaccg tgggcgccaatgggataccatctcaagtatgcggcggtagaattagaacgtaagcgtggt gacagaaatgagtggtattga

DBGET integrated database retrieval system