Halothece sp. PCC 7418: PCC7418_3573 Help Entry PCC7418_3573      CDS       T02379                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hao  Halothece sp. PCC 7418 Pathway hao00790   Folate biosynthesis hao01100   Metabolic pathways hao01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hao00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PCC7418_3573 Enzymes [BR:hao01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PCC7418_3573  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PCC7418_3573  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PCC7418_3573 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFZ45683 UniProt:  K9YHZ0 LinkDB All DBs Position 3871085..3871444 Genome browser AA seq 119 aa AA seqDB search MDTIKIENIRCYGYTGFLPEEQVLGQWFEVSLTLGVDLSLAGDSDEIRHTLDYRSAIAQV KQIIETEKFALIEKLAHAIAQAILQLDLVQQVCVELSKPAPPIPNFGGKITVTITREKT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacacgatcaaaattgagaatatccgttgctatggttatactggttttttgcccgaa gaacaagtgttaggacaatggtttgaggtgagtttaacgctcggggttgatttatctctt gcgggagacagtgacgagattaggcacactttagattaccgaagcgcgatcgcgcaagtc aaacaaattattgaaacggaaaaatttgctttaattgaaaaactcgcccacgcgatcgcg caagccattttacaattggatttagtgcaacaggtgtgtgtggaactctcgaaacccgcc cctcccattcctaactttggcgggaaaatcacagtcactattactcgtgaaaagacttaa

DBGET integrated database retrieval system