Halomonas sp. SH5A2: HXW73_13370 Help Entry HXW73_13370       CDS       T09591                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hash  Halomonas sp. SH5A2 Pathway hash00790   Folate biosynthesis hash01100   Metabolic pathways hash01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hash00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HXW73_13370 (folB) Enzymes [BR:hash01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HXW73_13370 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HXW73_13370 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HXW73_13370 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QNI03840 UniProt:  A0A7G7ZAR9 LinkDB All DBs Position 2879218..2879598 Genome browser AA seq 126 aa AA seqDB search MDRIFIEALEVDTIIGVYEWERTIHQSLRLDLTLAADIRSAAATDDLRLTLDYAAICQRI QQFADTHQFALVETFAERLAACLRNDFPISWLRLTVHKPGAVPNARSVGLEITRGTLPEE TGASAP NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggatcgcattttcatcgaagcgcttgaggtagataccatcattggcgtctacgaatgg gagcgcaccattcatcagtcgctgcgtctggacttaacgctggccgccgatatccgctcg gcggcggctaccgatgaccttcggctgacgctggattacgctgccatttgtcagcggatt caacagtttgctgatactcatcagtttgctttggtggaaaccttcgccgagcgcctggcc gcctgcctacgtaatgattttccaatcagctggctgcgacttaccgtccacaaacccggc gcagtccccaatgcacgcagcgtcggcctggaaatcacccgcggcacgctccccgaagaa accggagcatccgccccatga

DBGET integrated database retrieval system