Halomonas sp. 'Soap Lake #7': B2G49_01315 Help Entry B2G49_01315       CDS       T09182                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism haso  Halomonas sp. 'Soap Lake #7' Pathway haso00261   Monobactam biosynthesis haso01100   Metabolic pathways haso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haso00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B2G49_01315  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:haso01008]     B2G49_01315 Polyketide biosynthesis proteins [BR:haso01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B2G49_01315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQU85027 UniProt:  A0A1U9RFX5 LinkDB All DBs Position 302572..302817 Genome browser AA seq 81 aa AA seqDB search MTSCFDREDAVFRVLVNHEEQYSLWPEWKAIPAGWTDTGVLGDKPTCLDYVEKTWTDMRP LSLRQWMDEQQAAEAEPADAG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacaagttgttttgatcgtgaagatgctgttttccgcgtgttagttaaccacgaagag cagtactccctctggcctgagtggaaagcgattcctgctggttggacggataccggtgtg cttggcgataagccaacctgcctagattacgtcgaaaaaacctggaccgatatgcggccg ctctctctgcgtcagtggatggacgagcagcaggctgccgaagcggagccggcggatgca ggctaa

DBGET integrated database retrieval system