Halomonas sp. 'Soap Lake #7': B2G49_12430 Help Entry B2G49_12430       CDS       T09182                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism haso  Halomonas sp. 'Soap Lake #7' Pathway haso00790   Folate biosynthesis haso01100   Metabolic pathways haso01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:haso00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     B2G49_12430 Enzymes [BR:haso01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      B2G49_12430  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      B2G49_12430  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      B2G49_12430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AQU83303 UniProt:  A0A1U9RAY9 LinkDB All DBs Position 2725503..2725883 Genome browser AA seq 126 aa AA seqDB search MDRILIEALAVDTVIGVYDWERTIVQSLRLDLSLATDIRPAAAADDLRLTLDYAAICQRI QQFADEHQFALVETFAERLAECLRHEFSISWLRLTVRKPGAVPQAASVGLEITRGTLPGA IEAMHS NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggatcgcattttgatcgaagcattagcagtagacaccgtgatcggggtgtacgactgg gagcgcactattgttcaatcgctgcgtttggacttatcactcgcaacggatatacgccct gcggcggcggccgatgatttacgtctaacgcttgattatgccgctatttgccagcgaatc cagcaattcgccgatgagcatcagtttgccctagtagaaacatttgccgaacgcctcgcc gaatgtttacgccatgaattctcgattagctggttgcgacttaccgtgcgtaaaccaggt gccgttcctcaagcggcaagtgttgggcttgaaattacccgaggcacactcccgggggcc atcgaggcaatgcattcatga

DBGET integrated database retrieval system