Herpetosiphon aurantiacus: Haur_0026 Help Entry Haur_0026         CDS       T00614                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism hau  Herpetosiphon aurantiacus Pathway hau00261   Monobactam biosynthesis hau01100   Metabolic pathways hau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Haur_0026  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hau01008]     Haur_0026 Polyketide biosynthesis proteins [BR:hau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Haur_0026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABX02678 UniProt:  A9B4C1 LinkDB All DBs Position 33262..33489 Genome browser AA seq 75 aa AA seqDB search MGWNEEEDTTIYKVVVNHEEQYSIWPADRENPLGWNDEGKVGPKAECLEHIKQIWTDMRP LSLRKKMEELAREGQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgggttggaacgaagaagaagataccactatctacaaagttgtcgtgaatcatgaagag caatattcgatttggccagccgatcgtgaaaatccacttggctggaatgatgaaggtaaa gttggcccaaaagctgaatgtttagagcatatcaaacaaatttggacggatatgcgcccc ttgagtttgcgcaaaaaaatggaagaactggctcgcgaaggccaataa

DBGET integrated database retrieval system