Herpetosiphon aurantiacus: Haur_2109 Help Entry Haur_2109         CDS       T00614                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism hau  Herpetosiphon aurantiacus Pathway hau00261   Monobactam biosynthesis hau01100   Metabolic pathways hau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hau00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Haur_2109  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hau01008]     Haur_2109 Polyketide biosynthesis proteins [BR:hau01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Haur_2109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABX04749 UniProt:  A9AW99 LinkDB All DBs Position 2649436..2649651 Genome browser AA seq 71 aa AA seqDB search MQTTDDDTTIYNVVINHEEQYSIWPAERENPLGWSNVGVSGNKQTCLDHIKAVWTDMRPL SLRQALANQSA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgcaaacaacagatgacgatacaacaatctataacgttgtgatcaatcacgaagaacaa tactctatctggcctgccgaacgcgaaaacccgctgggctggagtaatgttggagtgagc ggcaataaacaaacctgtttagatcacattaaagcggtttggactgatatgcggccatta agtttacgccaagcgctagccaaccaatcggcttag

DBGET integrated database retrieval system