Helicoverpa armigera (cotton bollworm): 135117472 Help Entry 135117472         CDS       T05609                                  Name (RefSeq) insulin-related peptide 1-like   KO K05459   insulin-like growth factor 1 Organism haw  Helicoverpa armigera (cotton bollworm) Pathway haw04068   FoxO signaling pathway haw04150   mTOR signaling pathway haw04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:haw00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     135117472    04150 mTOR signaling pathway     135117472  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     135117472  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:haw04052]     135117472 Cytokines and neuropeptides [BR:haw04052]  Cytokines   Growth factors (RTK binding)    135117472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  135117472 NCBI-ProteinID:  XP_063892860 LinkDB All DBs Position 11:11335305..11335556 Genome browser AA seq 83 aa AA seqDB search MLKLLVVVSLVLVSADSQAAGGRAVLCGRQLSEAIATLCWPELDKRGWWPPAHHVLAGVR GKRGPVDECCLKACSIDEIMGYC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgttgaagctgctggtagtagtctcgctggtgctggtgagcgcggactcgcaggcggcg ggcgggcgcgccgtgctgtgcggccggcagctgtcggaggcgatcgcgacgctgtgctgg cccgagctggacaagcgcggctggtggccgccggcgcaccacgtgctggctggcgtgcgc ggcaagcgcggcccggtggacgagtgctgcctcaaggcctgctctattgatgaaattatg ggctattgctag

DBGET integrated database retrieval system