Halomonas axialensis: HAALTHF_14970n Help Entry HAALTHF_14970n    CDS       T06639                                  Name (GenBank) hypothetical protein   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism haxi  Halomonas axialensis Pathway haxi00010   Glycolysis / Gluconeogenesis haxi00053   Ascorbate and aldarate metabolism haxi00071   Fatty acid degradation haxi00280   Valine, leucine and isoleucine degradation haxi00310   Lysine degradation haxi00330   Arginine and proline metabolism haxi00340   Histidine metabolism haxi00380   Tryptophan metabolism haxi00410   beta-Alanine metabolism haxi00561   Glycerolipid metabolism haxi00620   Pyruvate metabolism haxi00625   Chloroalkane and chloroalkene degradation haxi00770   Pantothenate and CoA biosynthesis haxi01100   Metabolic pathways haxi01110   Biosynthesis of secondary metabolites haxi01120   Microbial metabolism in diverse environments haxi01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:haxi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HAALTHF_14970n    00053 Ascorbate and aldarate metabolism     HAALTHF_14970n    00620 Pyruvate metabolism     HAALTHF_14970n   09103 Lipid metabolism    00071 Fatty acid degradation     HAALTHF_14970n    00561 Glycerolipid metabolism     HAALTHF_14970n   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HAALTHF_14970n    00310 Lysine degradation     HAALTHF_14970n    00330 Arginine and proline metabolism     HAALTHF_14970n    00340 Histidine metabolism     HAALTHF_14970n    00380 Tryptophan metabolism     HAALTHF_14970n   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     HAALTHF_14970n   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     HAALTHF_14970n   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     HAALTHF_14970n   09111 Xenobiotics biodegradation and metabolism    00625 Chloroalkane and chloroalkene degradation     HAALTHF_14970n Enzymes [BR:haxi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      HAALTHF_14970n BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aldedh Motif Other DBs NCBI-ProteinID:  BBI71668 LinkDB All DBs Position 974543..974896 Genome browser AA seq 117 aa AA seqDB search MLPQLLTDIPDGHEVLREELFGPVLVVQVFEDEAEALALANATDFGLCAGIWTRDGGRQL RLAKGIRSGQVFINNYGAAGGVELPFGGVGRSGHGREKGFEGLRSYTRIKTIAIKHG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtgctgcctcaactgttgaccgatattccggatgggcatgaagtgcttcgggaggagctg tttggccccgtgctggtggtgcaggtgttcgaggatgaagccgaagcgcttgcactcgct aatgccaccgattttggcctgtgtgccggtatttggactcgcgacggcggacgtcagcta cgcttggcaaaaggtatccgcagtggccaagtgttcatcaataactacggagctgccggt ggcgtagagcttccctttggtggtgttggacgttcaggacatggtcgggaaaagggcttt gaagggctgagaagctatacacgtatcaagactatcgctatcaagcacggctag

DBGET integrated database retrieval system