Halarcobacter bivalviorum: ABIV_2233 Help Entry ABIV_2233         CDS       T06437                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hbv  Halarcobacter bivalviorum Pathway hbv00790   Folate biosynthesis hbv01100   Metabolic pathways hbv01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hbv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ABIV_2233 (folB) Enzymes [BR:hbv01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ABIV_2233 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ABIV_2233 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ABIV_2233 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AXH13208 UniProt:  A0A345J074 LinkDB All DBs Position 2247940..2248254 Genome browser AA seq 104 aa AA seqDB search MKISIENLTFKCIIGILDFERVKKQKVIIDIFFNYDYINNDTFIDYSEISSKVEKIMKKE KFELLEEAILYIEKFLSENYPIKNLKIKISKPNILKNCIVSLEN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaaaatctcaattgaaaatttaacttttaaatgtattattggaatacttgattttgaa agagtaaaaaaacaaaaagttattatagatattttctttaattatgattatattaataat gatacttttatagattattcagaaatttcttctaaagttgaaaagattatgaagaaagaa aagtttgaacttcttgaagaagcaattttatatattgaaaagtttctaagtgaaaattat cctatcaaaaacctaaaaattaaaatatcaaaacctaatattttaaaaaattgcattgtt tcattagaaaattaa

DBGET integrated database retrieval system