Hippocampus comes (tiger tail seahorse): 109508179 Help Entry 109508179         CDS       T04969                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq00860   Porphyrin metabolism hcq04216   Ferroptosis hcq04217   Necroptosis Brite KEGG Orthology (KO) [BR:hcq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109508179  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109508179    04217 Necroptosis     109508179  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109508179 Enzymes [BR:hcq01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109508179 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109508179   Exosomal proteins of bladder cancer cells    109508179 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Rubrerythrin FCH Motif Other DBs NCBI-GeneID:  109508179 NCBI-ProteinID:  XP_019713616 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search LIFVLNLQAFYFSRDDIALPGFAHFFKENSEEEREHADKLLAFQNNRGGRIFLQDIKKPE RDEWGSGLEAMQSALQLEKNVNQALLDLHKLASEHVDPH NT seq 298 nt NT seq  +upstreamnt  +downstreamnt gctgatttttgttttaaatctccaggccttttacttctcccgagatgacattgccctccc aggctttgcccatttcttcaaggagaacagtgaggaggagagggaacacgctgacaagtt gctggccttccagaacaatagaggtggacgcatcttcctccaggatatcaagaaaccaga gcgtgatgagtggggaagtggactcgaggcgatgcagtctgccctacagctggagaaaaa tgttaaccaggctctcctcgacctgcacaaattggcctctgagcatgtggatccccat

DBGET integrated database retrieval system