Halalkaliarchaeum desulfuricum: AArcSl_0234 Help Entry AArcSl_0234       CDS       T06283                                  Symbol panD Name (GenBank) aspartate 1-decarboxylase   KO K01579   aspartate 1-decarboxylase [EC:4.1.1.11] Organism hdf  Halalkaliarchaeum desulfuricum Pathway hdf00410   beta-Alanine metabolism hdf00770   Pantothenate and CoA biosynthesis hdf01100   Metabolic pathways hdf01110   Biosynthesis of secondary metabolites hdf01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hdf00001]  09100 Metabolism   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     AArcSl_0234 (panD)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AArcSl_0234 (panD) Enzymes [BR:hdf01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.1  Carboxy-lyases     4.1.1.11  aspartate 1-decarboxylase      AArcSl_0234 (panD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_decarbox Motif Other DBs NCBI-ProteinID:  AUX07889 UniProt:  A0A343TFL7 LinkDB All DBs Position complement(229708..229989) Genome browser AA seq 93 aa AA seqDB search MDPRTAFWWGTGSKLEAADIAVHEKVQVVNVDNGERFETYAIPGDYVDICLNGAAARLAA VGDRLIIMAYGGFDDEILEPTVVRLDDNNEPIE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggatccgcgaactgctttctggtggggaaccggttcgaaactcgaggcggccgacatc gcagtacacgagaaggttcaggtggtgaacgtcgacaacggcgagcggttcgagacgtat gcgattcccggcgactacgtcgatatctgtctcaacggcgcggccgcccggctggctgcg gtcggcgatcggctcatcattatggcatacggcgggttcgacgacgagatcctcgagccg acggtcgtcaggctcgacgataacaacgaaccgatcgagtag

DBGET integrated database retrieval system