Herbaspirillum sp. meg3: hmeg3_11635 Help Entry hmeg3_11635       CDS       T05024                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism hee  Herbaspirillum sp. meg3 Pathway hee00261   Monobactam biosynthesis hee01100   Metabolic pathways hee01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hee00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     hmeg3_11635  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hee01008]     hmeg3_11635 Polyketide biosynthesis proteins [BR:hee01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     hmeg3_11635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASU38874 UniProt:  A0A223PA51 LinkDB All DBs Position 2569532..2569759 Genome browser AA seq 75 aa AA seqDB search MSFDRDDTNFRVLVNHEEQYSIWPDYKAVPGGWRDTGVAGSKSDCLQYIESTWTDMRPRS LREYMQDQDVTAPQN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgagtttcgatcgagacgataccaatttccgcgtgttggtgaaccacgaagagcaatat tccatctggcccgactacaaagcagttccgggcggctggcgcgataccggtgtggcagga agcaagtcagactgtttgcaatacatcgaaagcacatggaccgacatgcgcccgcgcagc ctgcgtgaatacatgcaggatcaggacgtcactgcgccgcagaactag

DBGET integrated database retrieval system