Helicobacter pylori F16: HPF16_1410 Help Entry HPF16_1410        CDS       T01910                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hef  Helicobacter pylori F16 Pathway hef00790   Folate biosynthesis hef01100   Metabolic pathways hef01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hef00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HPF16_1410 (folB) Enzymes [BR:hef01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HPF16_1410 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HPF16_1410 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HPF16_1410 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB NEMO Mad3_BUB1_II PRONE Endotoxin_N Motif Other DBs NCBI-ProteinID:  BAJ56007 LinkDB All DBs Position 1474274..1474627 Genome browser AA seq 117 aa AA seqDB search MKTQQGVHIHNLVFETILGILEFERLKPQKISVNLDLFYTELPNKAYLDYIKIQELIQKM MQENQYLLIEDALKDLSHALKTRYNEISELHLKISKLEISPNSQVGASVKICYENDL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaacccaacaaggcgttcatatccataaccttgtgtttgaaacgattttggggatt ttagaatttgaacgcttaaaaccccaaaaaataagcgtgaatttggatcttttctacaca gaattacccaataaggcttatttagactacataaaaatccaagagcttatccaaaaaatg atgcaagaaaaccaatacttactcattgaagacgctctgaaagatttgagccatgcttta aaaacgcgctacaatgaaatctctgagcttcatttaaaaatcagcaaattagaaatttct ccaaattctcaagtgggagcgagcgtgaaaatttgctatgaaaacgatctttag

DBGET integrated database retrieval system