Helicobacter enhydrae: BBW65_04910 Help Entry BBW65_04910       CDS       T05984                                  Name (GenBank) hypothetical protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism het  Helicobacter enhydrae Pathway het00790   Folate biosynthesis het01100   Metabolic pathways het01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:het00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BBW65_04910 Enzymes [BR:het01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BBW65_04910  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BBW65_04910  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BBW65_04910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB TOR1A_C DUF5053 Motif Other DBs NCBI-ProteinID:  ANV98180 UniProt:  A0A1B1U601 LinkDB All DBs Position 1039744..1040073 Genome browser AA seq 109 aa AA seqDB search MQIIIENLELEVIIGVLPFEREKPQKILLSAELFYSYAGVYLDYRQVIECLTENLQTQKY EILEDALQDLARKLHRAFPQFYKMILLIQKPDIFANCSIGVREVFDFKD NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcatcattgaaaatcttgagcttgaagtcattatcggggttttgccatttgag agagaaaaaccccaaaaaatcctcctaagtgcagaattattttattcttatgcaggggta tatttagactataggcaagtgatagagtgtttgactgaaaatctacagacacaaaagtat gagattttggaagatgctttgcaagatttggctagaaaattacatagggcttttcctcaa ttctacaaaatgatacttttgattcaaaagcctgatatttttgcaaattgtagtatcgga gtgagagaagtttttgattttaaggattaa

DBGET integrated database retrieval system