Hyphococcus flavus: PUV54_01650 Help Entry PUV54_01650       CDS       T08821                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism hfl  Hyphococcus flavus Pathway hfl00261   Monobactam biosynthesis hfl01100   Metabolic pathways hfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hfl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PUV54_01650  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hfl01008]     PUV54_01650 Polyketide biosynthesis proteins [BR:hfl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PUV54_01650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WDI31892 LinkDB All DBs Position complement(312411..312647) Genome browser AA seq 78 aa AA seqDB search MANPFDDENGTFLILVNEEGQHSLWPDFIDVPPGWEQVGPTGSKALCSAWIDENWTDMRP KSLIRQMEEDERQRQAND NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccatttgacgatgaaaacgggacattcctgatccttgtgaatgaagaaggc caacattcactctggcccgacttcatcgatgtgccacctggctgggagcaggtcgggccg acaggatcgaaagcgctttgttctgcgtggatcgacgagaactggaccgacatgagaccg aaaagcctgatccggcagatggaagaagacgagcgtcagcgtcaggcaaacgactaa

DBGET integrated database retrieval system