Helicobacter hepaticus: HH_0924 Help Entry HH_0924           CDS       T00133                                  Name (GenBank) conserved hypothetical protein   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hhe  Helicobacter hepaticus Pathway hhe00790   Folate biosynthesis hhe01100   Metabolic pathways hhe01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hhe00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HH_0924 Enzymes [BR:hhe01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HH_0924  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HH_0924  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HH_0924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAP77521 UniProt:  Q7VHP0 LinkDB All DBs Position 895498..895833 Genome browser AA seq 111 aa AA seqDB search MEQITLHIENLTFEAIIGILECERLNPQKILVEAHITYTYQSEHYLDYVLISEIIRHHLQ TKTYELLESALIDIIDDLKAQFNTITCITLCIKKPDILAPLVVGASVTKTF NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggagcaaattacactacacattgagaatctcacctttgaagcaattattggaatctta gagtgtgagcggcttaacccacaaaaaatccttgttgaagcacatatcacctatacttat caatcggagcactatcttgattatgtgcttataagcgagattatccgtcatcatctccaa acaaagacttatgagcttttagaatctgcgcttattgacattattgatgatctcaaagca caatttaatacgataacttgtatcactttatgcatcaaaaagcccgatattcttgctcca cttgtcgttggtgcaagtgttactaagacattttaa

DBGET integrated database retrieval system