Hyaena hyaena (striped hyena): 120231517 Help Entry 120231517         CDS       T07257                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv01523   Antifolate resistance hhv04010   MAPK signaling pathway hhv04060   Cytokine-cytokine receptor interaction hhv04064   NF-kappa B signaling pathway hhv04217   Necroptosis hhv04380   Osteoclast differentiation hhv04620   Toll-like receptor signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04623   Cytosolic DNA-sensing pathway hhv04625   C-type lectin receptor signaling pathway hhv04640   Hematopoietic cell lineage hhv04657   IL-17 signaling pathway hhv04659   Th17 cell differentiation hhv04668   TNF signaling pathway hhv04750   Inflammatory mediator regulation of TRP channels hhv04932   Non-alcoholic fatty liver disease hhv04933   AGE-RAGE signaling pathway in diabetic complications hhv04936   Alcoholic liver disease hhv04940   Type I diabetes mellitus hhv05010   Alzheimer disease hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05132   Salmonella infection hhv05133   Pertussis hhv05134   Legionellosis hhv05135   Yersinia infection hhv05140   Leishmaniasis hhv05142   Chagas disease hhv05143   African trypanosomiasis hhv05144   Malaria hhv05146   Amoebiasis hhv05152   Tuberculosis hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05168   Herpes simplex virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05321   Inflammatory bowel disease hhv05323   Rheumatoid arthritis hhv05332   Graft-versus-host disease hhv05417   Lipid and atherosclerosis hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120231517 (IL1B)    04064 NF-kappa B signaling pathway     120231517 (IL1B)    04668 TNF signaling pathway     120231517 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120231517 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120231517 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120231517 (IL1B)    04620 Toll-like receptor signaling pathway     120231517 (IL1B)    04621 NOD-like receptor signaling pathway     120231517 (IL1B)    04623 Cytosolic DNA-sensing pathway     120231517 (IL1B)    04625 C-type lectin receptor signaling pathway     120231517 (IL1B)    04659 Th17 cell differentiation     120231517 (IL1B)    04657 IL-17 signaling pathway     120231517 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     120231517 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     120231517 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     120231517 (IL1B)    05164 Influenza A     120231517 (IL1B)    05162 Measles     120231517 (IL1B)    05168 Herpes simplex virus 1 infection     120231517 (IL1B)    05163 Human cytomegalovirus infection     120231517 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     120231517 (IL1B)    05135 Yersinia infection     120231517 (IL1B)    05133 Pertussis     120231517 (IL1B)    05134 Legionellosis     120231517 (IL1B)    05152 Tuberculosis     120231517 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     120231517 (IL1B)    05144 Malaria     120231517 (IL1B)    05140 Leishmaniasis     120231517 (IL1B)    05142 Chagas disease     120231517 (IL1B)    05143 African trypanosomiasis     120231517 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     120231517 (IL1B)    05321 Inflammatory bowel disease     120231517 (IL1B)    05332 Graft-versus-host disease     120231517 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     120231517 (IL1B)    05020 Prion disease     120231517 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     120231517 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120231517 (IL1B)    05418 Fluid shear stress and atherosclerosis     120231517 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     120231517 (IL1B)    04936 Alcoholic liver disease     120231517 (IL1B)    04932 Non-alcoholic fatty liver disease     120231517 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     120231517 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     120231517 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120231517 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120231517 (IL1B) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Interleukins    120231517 (IL1B) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Cytokines    120231517 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  120231517 NCBI-ProteinID:  XP_039087602 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MAAVPEPTSEMMAYYSDENSLFFEADGPEKMKGCLQNLSHRFLGDEGIQLQISHQLDSKS LRHAASVIVAMEKLKNISFPCSKPLQDDDLKSLFCCIFEEEPIVGDSWDDGFVTDVALQS RNCTFQDVKHKSLVLSGSYELRALHLNGQNMNQQVVFCMSFVQGEENSNKIPVVLCIKKN NLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKIEIKNTVEFESSQFPNWYISTS QAEEMPVFLGNTKGGQDITDFIMEISS NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaacccaccagtgagatgatggcttactacagcgatgagaattcc ctgttcttcgaggctgatggacccgaaaagatgaagggctgcctccaaaacctcagtcac agatttctgggagatgagggcatccagttgcaaatctcccaccagcttgacagcaagagt cttaggcatgccgcgtcagtcattgtggctatggagaagctgaagaacatatcttttcca tgctcaaagcccctgcaggatgatgacctgaagagcctcttctgctgtatctttgaagaa gaacccatcgtcggtgactcatgggatgatggctttgtgactgatgtggccctacagtca cggaactgcacattccaagacgtaaaacacaagagcctggtgctgtctggctcctatgag cttcgggctctccatctcaatggacagaatatgaaccaacaagtggtgttctgcatgagc tttgtacaaggggaggaaaatagtaacaagataccagtggtgctgtgcatcaagaaaaat aatctgtacctgtcctgtgtgatgaaagacgggaaacccaccctgcagctggagatgtta gaccccaaagtttacccaaagaagaagatggaaaagagatttgtcttcaacaagatagaa atcaagaacacagtggaatttgagtcttcccagttccccaactggtacatcagcacctct caagcagaagaaatgcctgtcttcctaggaaataccaaaggtggtcaggatataactgat ttcatcatggaaatctcttcctaa

DBGET integrated database retrieval system