Haemophilus influenzae Hi375: NF38_04075 Help Entry NF38_04075        CDS       T03485                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hih  Haemophilus influenzae Hi375 Pathway hih00790   Folate biosynthesis hih01100   Metabolic pathways hih01240   Biosynthesis of cofactors Module hih_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hih00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     NF38_04075 Enzymes [BR:hih01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      NF38_04075  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      NF38_04075  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      NF38_04075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIT67413 LinkDB All DBs Position 793200..793556 Genome browser AA seq 118 aa AA seqDB search MDRVFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWDCKQAAETDDVAYCLNYAEVSQVI IDYVESKPFLLIERVAYEVADLLESRYQLQGLKIKLSKPKAVAQARNVGVLIIRGCLK NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatcgtgtttttattgaagaattgactgtttttgcacaaatcggtgtatatgattgg gaacagcaaataaaacaaaaacttgtgtttgatttggaaatggcttgggattgtaaacaa gcggcagaaacggatgatgttgcatattgtttaaattatgctgaagtgagccaagtgata attgattatgtggaaagtaaacctttcttgctgattgagcgagtggcttatgaagtggcg gatttgcttgagtcacgttatcaacttcaaggattaaaaattaaactgagtaaaccaaaa gccgtcgcgcaagctcgaaatgttggcgtattgattattcgtggttgtttaaaataa

DBGET integrated database retrieval system