Halobacterium litoreum: LT972_03625 Help Entry LT972_03625       CDS       T07867                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hlu  Halobacterium litoreum Pathway hlu00280   Valine, leucine and isoleucine degradation hlu00630   Glyoxylate and dicarboxylate metabolism hlu00640   Propanoate metabolism hlu01100   Metabolic pathways hlu01110   Biosynthesis of secondary metabolites hlu01120   Microbial metabolism in diverse environments hlu01200   Carbon metabolism Module hlu_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hlu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     LT972_03625    00640 Propanoate metabolism     LT972_03625   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     LT972_03625 Enzymes [BR:hlu01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      LT972_03625     6.4.1.3  propionyl-CoA carboxylase      LT972_03625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  OAD_gamma Motif Other DBs NCBI-ProteinID:  UHH14096 LinkDB All DBs Position 651253..651510 Genome browser AA seq 85 aa AA seqDB search MAVTDPDLRIPDDATDEEAAAIAAAVSAHLARLEAEASDDAETDSWDGEKWSFAGRVEAL GGAPTRVPDGAPTDAWSAAGRRERF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccgtgaccgacccagacctccggattccggacgacgccaccgacgaggaggcggcc gccatcgccgcggcggtgagcgcgcacctcgcgcgcctcgaagccgaggccagcgacgac gcggagaccgactcctgggacggggagaagtggtcgttcgcggggcgcgtcgaggcgctc ggcggcgcaccgacgcgcgtgccggacggcgcgccgacggacgcgtggagcgcggcgggt cgccgcgagcggttctga

DBGET integrated database retrieval system