Halomicrobium mukohataei: Hmuk_2282 Help Entry Hmuk_2282         CDS       T00982                                  Name (GenBank) conserved hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hmu  Halomicrobium mukohataei Pathway hmu00280   Valine, leucine and isoleucine degradation hmu00630   Glyoxylate and dicarboxylate metabolism hmu00640   Propanoate metabolism hmu01100   Metabolic pathways hmu01110   Biosynthesis of secondary metabolites hmu01120   Microbial metabolism in diverse environments hmu01200   Carbon metabolism Module hmu_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hmu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Hmuk_2282    00640 Propanoate metabolism     Hmuk_2282   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Hmuk_2282 Enzymes [BR:hmu01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      Hmuk_2282     6.4.1.3  propionyl-CoA carboxylase      Hmuk_2282 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YukD Motif Other DBs NCBI-ProteinID:  ACV48394 UniProt:  C7NXG0 LinkDB All DBs Position 2204626..2204961 Genome browser AA seq 111 aa AA seqDB search MSSLEPTDDEEPTDDADETTVTVTAGDRELDVSLPDDASSSEAAAIASAISAHVTDRQRA AAAAAAARDDGPEYANEWVLEGRLERFGKRRRPQRVEKGDEWKAAGRSFYR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcactcgaaccaactgacgacgaggaaccgaccgacgacgccgacgagacgacg gtgaccgtcactgccggcgaccgggaactggacgtgtcgctcccggacgacgcgtcgtcg tccgaggccgcggccatcgcctcggcgatcagtgcccacgtcacggatcgccagcgcgct gcggccgccgcggcagcggcgcgcgacgacggacccgagtacgccaacgagtgggtactc gaagggcgtctcgaacgcttcggcaagcgccgccgtccacagcgcgtcgagaagggcgac gagtggaaggcggccggtcggtcgttctatcggtag

DBGET integrated database retrieval system