Vreelandella neptunia: SR894_04085 Help Entry SR894_04085       CDS       T09634                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism hnp  Vreelandella neptunia Pathway hnp00261   Monobactam biosynthesis hnp01100   Metabolic pathways hnp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hnp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SR894_04085  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hnp01008]     SR894_04085 Polyketide biosynthesis proteins [BR:hnp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SR894_04085 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WQH13725 LinkDB All DBs Position 862087..862332 Genome browser AA seq 81 aa AA seqDB search MTSCFDREDGVFRVLVNHEEQYSLWPEWKAIPAGWTDTGVLGDKPTCLDYVEKTWTDMRP LSLRQWMDEQAGAEAEQVNAG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacaagctgttttgatcgtgaagatggtgtcttccgcgtattagtcaaccacgaagag cagtactccctctggccagaatggaaagcgattcccgcgggctggaccgataccggcgtg ctcggcgataaaccaacctgtctcgactacgtcgaaaaaacctggaccgatatgcggcca ctctcgctgcgccagtggatggatgagcaggccggcgctgaggcggagcaggtgaatgca ggttaa

DBGET integrated database retrieval system