Haliangium ochraceum: Hoch_1365 Help Entry Hoch_1365         CDS       T01103                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism hoh  Haliangium ochraceum Pathway hoh00261   Monobactam biosynthesis hoh01100   Metabolic pathways hoh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hoh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Hoch_1365  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hoh01008]     Hoch_1365 Polyketide biosynthesis proteins [BR:hoh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Hoch_1365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACY13919 UniProt:  D0LUM9 LinkDB All DBs Position 1810671..1810907 Genome browser AA seq 78 aa AA seqDB search MPRASVTIATKQRTTMYIVVVNHEEQYSIWPEDRAVPDGWRGAGKAGSKEECLVYVEQIW TDMRPLSLRQGGDSNQSR NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgcctcgagcgagcgtgacaatcgcaactaagcagagaacaactatgtatatcgtcgtt gtcaatcacgaagaacagtattctatttggcctgaagatcgcgctgtgcccgatggctgg cgcggtgcgggtaaagccggctcgaaggaggaatgcctggtctatgtcgagcagatatgg acggatatgaggcccctcagcctgcgccagggcggggattccaaccagtcccgttga

DBGET integrated database retrieval system