Vreelandella olivaria: HORIV_71780 Help Entry HORIV_71780       CDS       T06227                                  Name (GenBank) hypothetical protein   KO K10806   acyl-CoA thioesterase YciA [EC:3.1.2.-] Organism hol  Vreelandella olivaria Pathway hol01040   Biosynthesis of unsaturated fatty acids Brite KEGG Orthology (KO) [BR:hol00001]  09100 Metabolism   09103 Lipid metabolism    01040 Biosynthesis of unsaturated fatty acids     HORIV_71780  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:hol01004]     HORIV_71780 Lipid biosynthesis proteins [BR:hol01004]  Fatty acid synthase   Component type    HORIV_71780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  4HBT EMP24_GP25L Motif Other DBs NCBI-ProteinID:  BBI54757 LinkDB All DBs Position complement(4867722..4867919) Genome browser AA seq 65 aa AA seqDB search MRVGSMVSVYTQVQDIGHSSIKIDVEVWVRPPHGQRIEERQKVTEARFVMVALDDNGRIR AVHSD NT seq 198 nt NT seq  +upstreamnt  +downstreamnt gtgcgcgttggctcgatggtcagcgtttacacccaggtacaagacattggccatagttca atcaagattgatgtggaagtttgggtgcgccctccccatgggcaacgcatagaagagcgc cagaaagtcaccgaggcgcgctttgtgatggtcgcgctggacgataatgggcgcatccga gcggtgcatagcgactaa

DBGET integrated database retrieval system