Helicobacter pylori J99: jhp_1403 Help Entry jhp_1403          CDS       T00020                                  Symbol folB Name (GenBank) DIHYDRONEOPTERIN ALDOLASE   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hpj  Helicobacter pylori J99 Pathway hpj00790   Folate biosynthesis hpj01100   Metabolic pathways hpj01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:hpj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     jhp_1403 (folB) Enzymes [BR:hpj01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      jhp_1403 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      jhp_1403 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      jhp_1403 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB PRONE Motif Other DBs NCBI-ProteinID:  AAD06984 UniProt:  Q9ZJB0 LinkDB All DBs Position 1535321..1535674 Genome browser AA seq 117 aa AA seqDB search MKTKQAVHIHNLVFETILGILEFERLKPQKISVDLDLFYTELPNKAYLDYMEIQEIIQNT MREKQYLLIEDALKDLSQILKTRYKKISELFLKISKLEISPNSQVGASMKIYYETNL NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaaaactaaacaagccgtccatatccataacttggtgtttgaaacgattttagggatt ttagagtttgaacgcttaaaaccccaaaaaataagcgtggatttggatcttttctacacg gaattacccaataaggcttatttggactacatggaaatccaagaaatcattcaaaacacc atgcgagaaaaacaataccttctcattgaagacgccttgaaagatttgagccaaatttta aaaacgcgctacaagaaaatctctgagctttttttgaaaatcagcaagttagaaatttct cccaattctcaagtgggggcgagcatgaaaatttactatgaaaccaatctttag

DBGET integrated database retrieval system