Helicovermis profundi: HLPR_05240 Help Entry HLPR_05240        CDS       T09891                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hprf  Helicovermis profundi Pathway hprf00020   Citrate cycle (TCA cycle) hprf01100   Metabolic pathways hprf01110   Biosynthesis of secondary metabolites hprf01120   Microbial metabolism in diverse environments hprf01200   Carbon metabolism hprf01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hprf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HLPR_05240 Enzymes [BR:hprf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HLPR_05240 BRITE hierarchy Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_22 Fer4_8 Fer4_3 Fer4_17 Fer4_13 BD_b_sandwich Fer4_18 Motif Other DBs NCBI-ProteinID:  BEP28193 LinkDB All DBs Position 599686..599913 Genome browser AA seq 75 aa AA seqDB search MAKAKGKVEFKEDICKGCGLCVNACPVNIISLDNDRINVKGYHPAFVAEMDKCIGCANCA TMCPDSVITVEREMV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaggctaagggtaaagtggaatttaaagaagatatttgtaaaggctgtggactt tgtgtgaatgcttgtccagttaacattatttctttagataatgacagaattaacgttaag ggttatcatccagcgtttgtagcagaaatggataaatgtataggatgtgcaaattgcgct acaatgtgtccggattcagtaattactgttgaaagagaaatggtttaa

DBGET integrated database retrieval system