Helicobacter pylori oki102: HPOKI102_05835 Help Entry HPOKI102_05835    CDS       T03182                                  Symbol porD Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism hpyb  Helicobacter pylori oki102 Pathway hpyb00010   Glycolysis / Gluconeogenesis hpyb00020   Citrate cycle (TCA cycle) hpyb00620   Pyruvate metabolism hpyb00640   Propanoate metabolism hpyb00650   Butanoate metabolism hpyb00680   Methane metabolism hpyb01100   Metabolic pathways hpyb01110   Biosynthesis of secondary metabolites hpyb01120   Microbial metabolism in diverse environments hpyb01200   Carbon metabolism hpyb01210   2-Oxocarboxylic acid metabolism Module hpyb_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:hpyb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HPOKI102_05835 (porD)    00020 Citrate cycle (TCA cycle)     HPOKI102_05835 (porD)    00620 Pyruvate metabolism     HPOKI102_05835 (porD)    00640 Propanoate metabolism     HPOKI102_05835 (porD)    00650 Butanoate metabolism     HPOKI102_05835 (porD)   09102 Energy metabolism    00680 Methane metabolism     HPOKI102_05835 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     HPOKI102_05835 (porD) Enzymes [BR:hpyb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      HPOKI102_05835 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_10 Fer4_21 Fer4 Fer4_7 Fer4_9 Fer4_6 Fer4_2 Fer4_8 Fer4_17 Fer4_15 Fer4_16 Fer4_13 Fer4_4 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  AHN35064 LinkDB All DBs Position 1185407..1185799 Genome browser AA seq 130 aa AA seqDB search MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ WPQKQEKKKS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaagaacgcg caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagttacttcacc acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgcatcaat tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaaatta aagggcgtggattattctcattgtaagggctgtggcgtgtgcgtggatgtctgccccact aaccctaaatcgctatggatgtttgaagaacaaattgagcctgccaccgctctcactcaa tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system