Helicobacter pylori oki128: HPOKI128_05240 Help Entry HPOKI128_05240    CDS       T03724                                  Symbol porD Name (GenBank) ferredoxin   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism hpyd  Helicobacter pylori oki128 Pathway hpyd00010   Glycolysis / Gluconeogenesis hpyd00020   Citrate cycle (TCA cycle) hpyd00620   Pyruvate metabolism hpyd00640   Propanoate metabolism hpyd00650   Butanoate metabolism hpyd00680   Methane metabolism hpyd01100   Metabolic pathways hpyd01110   Biosynthesis of secondary metabolites hpyd01120   Microbial metabolism in diverse environments hpyd01200   Carbon metabolism hpyd01210   2-Oxocarboxylic acid metabolism Module hpyd_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:hpyd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     HPOKI128_05240 (porD)    00020 Citrate cycle (TCA cycle)     HPOKI128_05240 (porD)    00620 Pyruvate metabolism     HPOKI128_05240 (porD)    00640 Propanoate metabolism     HPOKI128_05240 (porD)    00650 Butanoate metabolism     HPOKI128_05240 (porD)   09102 Energy metabolism    00680 Methane metabolism     HPOKI128_05240 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     HPOKI128_05240 (porD) Enzymes [BR:hpyd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      HPOKI128_05240 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_10 Fer4_21 Fer4 Fer4_7 Fer4_6 Fer4_9 Fer4_2 Fer4_8 Fer4_17 Fer4_15 Fer4_16 Fer4_4 Fer4_13 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  AHN37907 LinkDB All DBs Position 1067119..1067511 Genome browser AA seq 130 aa AA seqDB search MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIDPASALTQ WPQKQEKKKS NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaat tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaagtta aaaggtgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc aaccccaaatcgctatggatgtttgaagaacaaattgatcctgctagcgccctcactcaa tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system