Herbaspirillum rubrisubalbicans: Hrubri_2248 Help Entry Hrubri_2248       CDS       T04238                                  Name (GenBank) MbtH domain containing protein   KO K05375   MbtH protein Organism hrb  Herbaspirillum rubrisubalbicans Pathway hrb00261   Monobactam biosynthesis hrb01100   Metabolic pathways hrb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hrb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Hrubri_2248  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hrb01008]     Hrubri_2248 Polyketide biosynthesis proteins [BR:hrb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Hrubri_2248 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALU89438 UniProt:  A0A0U3K036 LinkDB All DBs Position 2616773..2617042 Genome browser AA seq 89 aa AA seqDB search MSTSCFDREDETFIVLINHEGQYSIWPHWKKVPGGWTVVNDAQGQPVKGLKKTVSDYIEQ HWTDMRPISLRKWMSEQAAEAGATTPVTQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaccagctgtttcgatcgcgaagacgaaaccttcatcgtcctgatcaatcacgaa ggccagtattcgatctggccccattggaagaaagtccccggaggctggaccgtggtcaac gatgcccagggccagccggtcaaggggctcaaaaagaccgtctcggattatatcgagcag cactggaccgacatgcgtccgatatcgctgcgtaaatggatgagcgaacaagccgccgaa gcgggtgcgaccacgcctgtcacgcagtga

DBGET integrated database retrieval system