Homo sapiens (human): 100532726 Help Entry 100532726         CDS       T01001                                  Symbol NDUFC2-KCTD14 Name (RefSeq) NDUFC2-KCTD14 readthrough   KO K03968   NADH dehydrogenase (ubiquinone) 1 subunit C2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100532726 (NDUFC2-KCTD14)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     100532726 (NDUFC2-KCTD14)   09159 Environmental adaptation    04714 Thermogenesis     100532726 (NDUFC2-KCTD14)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100532726 (NDUFC2-KCTD14)   09164 Neurodegenerative disease    05010 Alzheimer disease     100532726 (NDUFC2-KCTD14)    05012 Parkinson disease     100532726 (NDUFC2-KCTD14)    05014 Amyotrophic lateral sclerosis     100532726 (NDUFC2-KCTD14)    05016 Huntington disease     100532726 (NDUFC2-KCTD14)    05020 Prion disease     100532726 (NDUFC2-KCTD14)    05022 Pathways of neurodegeneration - multiple diseases     100532726 (NDUFC2-KCTD14)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     100532726 (NDUFC2-KCTD14)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100532726 (NDUFC2-KCTD14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_C2 HL_N-beta Motif Other DBs NCBI-GeneID:  100532726 NCBI-ProteinID:  NP_001190190 HGNC:  42956 Ensembl:  ENSG00000259112 UniProt:  E9PQ53 LinkDB All DBs Position 11:complement(78015715..78079862) Genome browser AA seq 114 aa AA seqDB search MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt cctgaagaagatgtctactgttgtggagctgaacgtcgggggtga

DBGET integrated database retrieval system