Homo sapiens (human): 3108 Help Entry 3108              CDS       T01001                                  Symbol HLA-DMA, D6S222E, DMA, HLADM, RING6 Name (RefSeq) major histocompatibility complex, class II, DM alpha   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00083   Allograft rejection Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3108 (HLA-DMA)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3108 (HLA-DMA)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3108 (HLA-DMA)    04612 Antigen processing and presentation     3108 (HLA-DMA)    04658 Th1 and Th2 cell differentiation     3108 (HLA-DMA)    04659 Th17 cell differentiation     3108 (HLA-DMA)    04672 Intestinal immune network for IgA production     3108 (HLA-DMA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3108 (HLA-DMA)    05164 Influenza A     3108 (HLA-DMA)    05168 Herpes simplex virus 1 infection     3108 (HLA-DMA)    05169 Epstein-Barr virus infection     3108 (HLA-DMA)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3108 (HLA-DMA)    05152 Tuberculosis     3108 (HLA-DMA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3108 (HLA-DMA)    05140 Leishmaniasis     3108 (HLA-DMA)   09163 Immune disease    05310 Asthma     3108 (HLA-DMA)    05322 Systemic lupus erythematosus     3108 (HLA-DMA)    05323 Rheumatoid arthritis     3108 (HLA-DMA)    05320 Autoimmune thyroid disease     3108 (HLA-DMA)    05321 Inflammatory bowel disease     3108 (HLA-DMA)    05330 Allograft rejection     3108 (HLA-DMA)    05332 Graft-versus-host disease     3108 (HLA-DMA)   09166 Cardiovascular disease    05416 Viral myocarditis     3108 (HLA-DMA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3108 (HLA-DMA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3108 (HLA-DMA) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3108 (HLA-DMA)   Exosomal proteins of epithelial cells    3108 (HLA-DMA)   Exosomal proteins of breast milk    3108 (HLA-DMA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set FAST_1 Motif Other DBs NCBI-GeneID:  3108 NCBI-ProteinID:  NP_006111 OMIM:  142855 HGNC:  4934 Ensembl:  ENSG00000204257 UniProt:  Q31604 Q6ICR9 Structure PDB LinkDB All DBs Position 6:complement(32948618..32953097) Genome browser AA seq 261 aa AA seqDB search MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVD GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG VLGIIVGIVLIIYFRKPCSGD NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atgggtcatgaacagaaccaaggagctgcgctgctacagatgttaccacttctgtggctg ctaccccactcctgggccgtccctgaagctcctactccaatgtggccagatgacctgcaa aaccacacattcctgcacacagtgtactgccaggatgggagtcccagtgtgggactctct gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct cgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt gacaaagagttctgcgagtggatgatccagcaaatagggccaaaacttgatgggaaaatc ccggtgtccagagggtttcctatcgctgaagtgttcacgctgaagcccctggagtttggc aagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac tggcagcatcattccgtccctgtggaaggatttgggcctacttttgtctcagctgtcgat ggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacattttc tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtaccccgg aacgcactgccctcagatctgctggagaatgtgctgtgtggcgtggcctttggcctgggt gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt gactga

Homo sapiens (human): 3109 Help Entry 3109              CDS       T01001                                  Symbol HLA-DMB, D6S221E, RING7 Name (RefSeq) major histocompatibility complex, class II, DM beta   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3109 (HLA-DMB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3109 (HLA-DMB)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3109 (HLA-DMB)    04612 Antigen processing and presentation     3109 (HLA-DMB)    04658 Th1 and Th2 cell differentiation     3109 (HLA-DMB)    04659 Th17 cell differentiation     3109 (HLA-DMB)    04672 Intestinal immune network for IgA production     3109 (HLA-DMB)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3109 (HLA-DMB)    05164 Influenza A     3109 (HLA-DMB)    05168 Herpes simplex virus 1 infection     3109 (HLA-DMB)    05169 Epstein-Barr virus infection     3109 (HLA-DMB)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3109 (HLA-DMB)    05152 Tuberculosis     3109 (HLA-DMB)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3109 (HLA-DMB)    05140 Leishmaniasis     3109 (HLA-DMB)   09163 Immune disease    05310 Asthma     3109 (HLA-DMB)    05322 Systemic lupus erythematosus     3109 (HLA-DMB)    05323 Rheumatoid arthritis     3109 (HLA-DMB)    05320 Autoimmune thyroid disease     3109 (HLA-DMB)    05321 Inflammatory bowel disease     3109 (HLA-DMB)    05330 Allograft rejection     3109 (HLA-DMB)    05332 Graft-versus-host disease     3109 (HLA-DMB)   09166 Cardiovascular disease    05416 Viral myocarditis     3109 (HLA-DMB)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3109 (HLA-DMB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3109 (HLA-DMB) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3109 (HLA-DMB)   Exosomal proteins of epithelial cells    3109 (HLA-DMB)   Exosomal proteins of breast milk    3109 (HLA-DMB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set MHC_II_beta Ig_3 Ig_2 C2-set_2 I-set SPARK ig Motif Other DBs NCBI-GeneID:  3109 NCBI-ProteinID:  NP_002109 OMIM:  142856 HGNC:  4935 Ensembl:  ENSG00000242574 UniProt:  P28068 A0A1V0E3P2 Structure PDB LinkDB All DBs Position 6:complement(32934636..32941028) Genome browser AA seq 263 aa AA seqDB search MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL ALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW RRAGHSSYTPLPGSNYSEGWHIS NT seq 792 nt NT seq  +upstreamnt  +downstreamnt atgatcacattcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc ttcgtggcccatgtggaaagcacctgtctgttggatgatgctgggactccaaaggatttc acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag atggccccttgcgaatttggggtgctgaatagcttggcgaatgtcctctcacagcacctc aaccaaaaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc tatccagcagaagtgactatcacgtggaggaagaacgggaagcttgtcatgcctcacagc agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta gccttaaccccctcttacggggacacttacacctgtgtggtagagcacactggggctcct gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagctgg cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggatgg cacatttcctag

Homo sapiens (human): 3111 Help Entry 3111              CDS       T01001                                  Symbol HLA-DOA, HLA-DNA, HLA-DZA, HLADZ Name (RefSeq) major histocompatibility complex, class II, DO alpha   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3111 (HLA-DOA)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3111 (HLA-DOA)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3111 (HLA-DOA)    04612 Antigen processing and presentation     3111 (HLA-DOA)    04658 Th1 and Th2 cell differentiation     3111 (HLA-DOA)    04659 Th17 cell differentiation     3111 (HLA-DOA)    04672 Intestinal immune network for IgA production     3111 (HLA-DOA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3111 (HLA-DOA)    05164 Influenza A     3111 (HLA-DOA)    05168 Herpes simplex virus 1 infection     3111 (HLA-DOA)    05169 Epstein-Barr virus infection     3111 (HLA-DOA)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3111 (HLA-DOA)    05152 Tuberculosis     3111 (HLA-DOA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3111 (HLA-DOA)    05140 Leishmaniasis     3111 (HLA-DOA)   09163 Immune disease    05310 Asthma     3111 (HLA-DOA)    05322 Systemic lupus erythematosus     3111 (HLA-DOA)    05323 Rheumatoid arthritis     3111 (HLA-DOA)    05320 Autoimmune thyroid disease     3111 (HLA-DOA)    05321 Inflammatory bowel disease     3111 (HLA-DOA)    05330 Allograft rejection     3111 (HLA-DOA)    05332 Graft-versus-host disease     3111 (HLA-DOA)   09166 Cardiovascular disease    05416 Viral myocarditis     3111 (HLA-DOA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3111 (HLA-DOA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3111 (HLA-DOA) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3111 (HLA-DOA)   Exosomal proteins of epithelial cells    3111 (HLA-DOA)   Exosomal proteins of breast milk    3111 (HLA-DOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 C2-set_2 Ig_2 Motif Other DBs NCBI-GeneID:  3111 NCBI-ProteinID:  NP_002110 OMIM:  142930 HGNC:  4936 Ensembl:  ENSG00000204252 UniProt:  P06340 X5CF87 A0A1V0E3Q8 A0A1V0E3Q5 A0A1V0E3N1 A0A1V0E3S6 A0A1V0E3M7 A0A1V0E3R3 A0A1V0E3S7 A0A1V0E3Q2 A0A1V0E3T1 A0A1V0E3P6 A0A1V0E3P8 A0A1V0E3N7 A0A1V0E3P1 A0A1V0E3P9 A0A1V0E3P3 A0A1V0E3R6 A0A1V0E3Q6 A0A1V0E3Q1 A0A1V0E3N3 A0A1V0E3S0 A0A1V0E3P0 A0A1V0E3R4 A0A1V0E3R0 A0A1V0E3Q4 A0A1V0E3N6 A0A1V0E3R8 A0A1V0E3S4 A0A1V0E3Q7 A0A1V0E3Q3 Structure PDB LinkDB All DBs Position 6:complement(33004182..33009591) Genome browser AA seq 250 aa AA seqDB search MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII MGTYVSSVPR NT seq 753 nt NT seq  +upstreamnt  +downstreamnt atggccctcagagcagggctggtcctggggttccacaccctgatgaccctcctgagcccg caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag tcttacggcgcctcgggccagttcacccatgaatttgatgaggaacagctgttctctgtg gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggtgactttgcccgcttt gacccgcagggcgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag tctcgggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc cctgtgatcaatatcacctggctgcgcaacggccaaactgtcactgagggagtggcccag accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg ccctcagccgaggacgtctatgactgccaggtggagcactggggcctggatgcgccactc ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc tgtgccctgggcctggccatcggcctggtgggcttcctcgtgggcaccgtcctcatcatc atgggcacatatgtgtccagtgtccccaggtaa

Homo sapiens (human): 3112 Help Entry 3112              CDS       T01001                                  Symbol HLA-DOB, DOB, HLA_DOB Name (RefSeq) major histocompatibility complex, class II, DO beta   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3112 (HLA-DOB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3112 (HLA-DOB)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3112 (HLA-DOB)    04612 Antigen processing and presentation     3112 (HLA-DOB)    04658 Th1 and Th2 cell differentiation     3112 (HLA-DOB)    04659 Th17 cell differentiation     3112 (HLA-DOB)    04672 Intestinal immune network for IgA production     3112 (HLA-DOB)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3112 (HLA-DOB)    05164 Influenza A     3112 (HLA-DOB)    05168 Herpes simplex virus 1 infection     3112 (HLA-DOB)    05169 Epstein-Barr virus infection     3112 (HLA-DOB)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3112 (HLA-DOB)    05152 Tuberculosis     3112 (HLA-DOB)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3112 (HLA-DOB)    05140 Leishmaniasis     3112 (HLA-DOB)   09163 Immune disease    05310 Asthma     3112 (HLA-DOB)    05322 Systemic lupus erythematosus     3112 (HLA-DOB)    05323 Rheumatoid arthritis     3112 (HLA-DOB)    05320 Autoimmune thyroid disease     3112 (HLA-DOB)    05321 Inflammatory bowel disease     3112 (HLA-DOB)    05330 Allograft rejection     3112 (HLA-DOB)    05332 Graft-versus-host disease     3112 (HLA-DOB)   09166 Cardiovascular disease    05416 Viral myocarditis     3112 (HLA-DOB)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3112 (HLA-DOB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3112 (HLA-DOB) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3112 (HLA-DOB)   Exosomal proteins of epithelial cells    3112 (HLA-DOB)   Exosomal proteins of breast milk    3112 (HLA-DOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set ig MHC_I C2-set_2 Motif Other DBs NCBI-GeneID:  3112 NCBI-ProteinID:  NP_002111 OMIM:  600629 HGNC:  4937 Ensembl:  ENSG00000241106 UniProt:  P13765 Q5QNS2 Structure PDB LinkDB All DBs Position 6:complement(32812763..32817002) Genome browser AA seq 273 aa AA seqDB search MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC NT seq 822 nt NT seq  +upstreamnt  +downstreamnt atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaagtggttcctgaat gggcaggaggagagagctggggtcatgtccactggccctatcaggaatggagactggacc tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt aatgaggtctcaagagctgttctgctccctcagtcatgctaa

Homo sapiens (human): 3113 Help Entry 3113              CDS       T01001                                  Symbol HLA-DPA1, DP(W3), DP(W4), DPA1, HLA-DP1A, HLA-DPA, HLA-DPB1, HLADP, HLASB, PLT1 Name (RefSeq) major histocompatibility complex, class II, DP alpha 1   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00294   Dilated cardiomyopathy Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3113 (HLA-DPA1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3113 (HLA-DPA1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3113 (HLA-DPA1)    04612 Antigen processing and presentation     3113 (HLA-DPA1)    04658 Th1 and Th2 cell differentiation     3113 (HLA-DPA1)    04659 Th17 cell differentiation     3113 (HLA-DPA1)    04672 Intestinal immune network for IgA production     3113 (HLA-DPA1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3113 (HLA-DPA1)    05164 Influenza A     3113 (HLA-DPA1)    05168 Herpes simplex virus 1 infection     3113 (HLA-DPA1)    05169 Epstein-Barr virus infection     3113 (HLA-DPA1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3113 (HLA-DPA1)    05152 Tuberculosis     3113 (HLA-DPA1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3113 (HLA-DPA1)    05140 Leishmaniasis     3113 (HLA-DPA1)   09163 Immune disease    05310 Asthma     3113 (HLA-DPA1)    05322 Systemic lupus erythematosus     3113 (HLA-DPA1)    05323 Rheumatoid arthritis     3113 (HLA-DPA1)    05320 Autoimmune thyroid disease     3113 (HLA-DPA1)    05321 Inflammatory bowel disease     3113 (HLA-DPA1)    05330 Allograft rejection     3113 (HLA-DPA1)    05332 Graft-versus-host disease     3113 (HLA-DPA1)   09166 Cardiovascular disease    05416 Viral myocarditis     3113 (HLA-DPA1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3113 (HLA-DPA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3113 (HLA-DPA1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3113 (HLA-DPA1)   Exosomal proteins of epithelial cells    3113 (HLA-DPA1)   Exosomal proteins of breast milk    3113 (HLA-DPA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Motif Other DBs NCBI-GeneID:  3113 NCBI-ProteinID:  NP_001229453 OMIM:  142880 HGNC:  4938 Ensembl:  ENSG00000231389 UniProt:  P20036 X5CKE2 Structure PDB LinkDB All DBs Position 6:complement(33064569..33080748) Genome browser AA seq 260 aa AA seqDB search MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG TVLIIKSLRSGHDPRAQGTL NT seq 783 nt NT seq  +upstreamnt  +downstreamnt atgcgccctgaagacagaatgttccatatcagagctgtgatcttgagagccctctccttg gctttcctgctgagtctccgaggagctggggccatcaaggcggaccatgtgtcaacttat gccgcgtttgtacagacgcatagaccaacaggggagtttatgtttgaatttgatgaagat gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc caagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac ttgaataccttgatccagcgttccaaccacactcaggccaccaacgatccccctgaggtg accgtgtttcccaaggagcctgtggagctgggccagcccaacaccctcatctgccacatt gacaagttcttcccaccagtgctcaacgtcacgtggctgtgcaacggggagctggtcact gagggtgtcgctgagagcctcttcctgcccagaacagattacagcttccacaagttccat tacctgacctttgtgccctcagcagaggacttctatgactgcagggtggagcactggggc ttggaccagccgctcctcaagcactgggaggcccaagagccaatccagatgcctgagaca acggagactgtgctctgtgccctgggcctggtgctgggcctagtcggcatcatcgtgggc accgtcctcatcataaagtctctgcgttctggccatgacccccgggcccaggggaccctg tga

Homo sapiens (human): 3115 Help Entry 3115              CDS       T01001                                  Symbol HLA-DPB1, DPB1, HLA-DP, HLA-DP1B, HLA-DPB Name (RefSeq) major histocompatibility complex, class II, DP beta 1   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00294   Dilated cardiomyopathy Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3115 (HLA-DPB1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3115 (HLA-DPB1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3115 (HLA-DPB1)    04612 Antigen processing and presentation     3115 (HLA-DPB1)    04658 Th1 and Th2 cell differentiation     3115 (HLA-DPB1)    04659 Th17 cell differentiation     3115 (HLA-DPB1)    04672 Intestinal immune network for IgA production     3115 (HLA-DPB1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3115 (HLA-DPB1)    05164 Influenza A     3115 (HLA-DPB1)    05168 Herpes simplex virus 1 infection     3115 (HLA-DPB1)    05169 Epstein-Barr virus infection     3115 (HLA-DPB1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3115 (HLA-DPB1)    05152 Tuberculosis     3115 (HLA-DPB1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3115 (HLA-DPB1)    05140 Leishmaniasis     3115 (HLA-DPB1)   09163 Immune disease    05310 Asthma     3115 (HLA-DPB1)    05322 Systemic lupus erythematosus     3115 (HLA-DPB1)    05323 Rheumatoid arthritis     3115 (HLA-DPB1)    05320 Autoimmune thyroid disease     3115 (HLA-DPB1)    05321 Inflammatory bowel disease     3115 (HLA-DPB1)    05330 Allograft rejection     3115 (HLA-DPB1)    05332 Graft-versus-host disease     3115 (HLA-DPB1)   09166 Cardiovascular disease    05416 Viral myocarditis     3115 (HLA-DPB1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3115 (HLA-DPB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3115 (HLA-DPB1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3115 (HLA-DPB1)   Exosomal proteins of epithelial cells    3115 (HLA-DPB1)   Exosomal proteins of breast milk    3115 (HLA-DPB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Marek_A Ig_2 C2-set_2 Motif Other DBs NCBI-GeneID:  3115 NCBI-ProteinID:  NP_002112 OMIM:  142858 HGNC:  4940 Ensembl:  ENSG00000223865 UniProt:  P04440 I4EC15 Structure PDB LinkDB All DBs Position 6:33075990..33089696 Genome browser AA seq 258 aa AA seqDB search MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC GVGIFMHRRSKKVQRGSA NT seq 777 nt NT seq  +upstreamnt  +downstreamnt atgatggttctgcaggtttctgcggccccccggacagtggctctgacggcgttactgatg gtgctgctcacatctgtggtccagggcagggccactccagagaattaccttttccaggga cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagatacatctacaac cgggaggagttcgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg gggcggcctgctgcggagtactggaacagccagaaggacatcctggaggagaagcgggca gtgccggacaggatgtgcagacacaactacgagctgggcgggcccatgaccctgcagcgc cgagtccagcctagggtgaatgtttccccctccaagaaggggcccttgcagcaccacaac ctgcttgtctgccacgtgacggatttctacccaggcagcattcaagtccgatggttcctg aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg accttccagatcctggtgatgctggaaatgaccccccagcagggagatgtctacacctgc caagtggagcacaccagcctggatagtcctgtcaccgtggagtggaaggcacagtctgat tctgcccggagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa

Homo sapiens (human): 3117 Help Entry 3117              CDS       T01001                                  Symbol HLA-DQA1, CELIAC1, DQ-A1, DQA1, HLA-DQA, HLA-DQA1*, HLA-DQB1 Name (RefSeq) major histocompatibility complex, class II, DQ alpha 1   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00080   Systemic lupus erythematosus H00294   Dilated cardiomyopathy H00408   Type 1 diabetes mellitus H01362   Dermatitis herpetiformis H02123   Celiac disease Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3117 (HLA-DQA1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3117 (HLA-DQA1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3117 (HLA-DQA1)    04612 Antigen processing and presentation     3117 (HLA-DQA1)    04658 Th1 and Th2 cell differentiation     3117 (HLA-DQA1)    04659 Th17 cell differentiation     3117 (HLA-DQA1)    04672 Intestinal immune network for IgA production     3117 (HLA-DQA1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3117 (HLA-DQA1)    05164 Influenza A     3117 (HLA-DQA1)    05168 Herpes simplex virus 1 infection     3117 (HLA-DQA1)    05169 Epstein-Barr virus infection     3117 (HLA-DQA1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3117 (HLA-DQA1)    05152 Tuberculosis     3117 (HLA-DQA1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3117 (HLA-DQA1)    05140 Leishmaniasis     3117 (HLA-DQA1)   09163 Immune disease    05310 Asthma     3117 (HLA-DQA1)    05322 Systemic lupus erythematosus     3117 (HLA-DQA1)    05323 Rheumatoid arthritis     3117 (HLA-DQA1)    05320 Autoimmune thyroid disease     3117 (HLA-DQA1)    05321 Inflammatory bowel disease     3117 (HLA-DQA1)    05330 Allograft rejection     3117 (HLA-DQA1)    05332 Graft-versus-host disease     3117 (HLA-DQA1)   09166 Cardiovascular disease    05416 Viral myocarditis     3117 (HLA-DQA1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3117 (HLA-DQA1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3117 (HLA-DQA1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3117 (HLA-DQA1)   Exosomal proteins of epithelial cells    3117 (HLA-DQA1)   Exosomal proteins of breast milk    3117 (HLA-DQA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 C2-set_2 Ig_2 I-set PA_Ig-like Motif Other DBs NCBI-GeneID:  3117 NCBI-ProteinID:  NP_002113 OMIM:  146880 HGNC:  4942 Ensembl:  ENSG00000196735 UniProt:  P01909 A0A173ADG5 Q8MH44 Structure PDB LinkDB All DBs Position 6:32637406..32655272 Genome browser AA seq 255 aa AA seqDB search MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII QGLRSVGASRHQGPL NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga

Homo sapiens (human): 3118 Help Entry 3118              CDS       T01001                                  Symbol HLA-DQA2, DC-alpha, DQA1, DX-ALPHA, HLA-DCA, HLA-DXA, HLADQA2 Name (RefSeq) major histocompatibility complex, class II, DQ alpha 2   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3118 (HLA-DQA2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3118 (HLA-DQA2)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3118 (HLA-DQA2)    04612 Antigen processing and presentation     3118 (HLA-DQA2)    04658 Th1 and Th2 cell differentiation     3118 (HLA-DQA2)    04659 Th17 cell differentiation     3118 (HLA-DQA2)    04672 Intestinal immune network for IgA production     3118 (HLA-DQA2)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3118 (HLA-DQA2)    05164 Influenza A     3118 (HLA-DQA2)    05168 Herpes simplex virus 1 infection     3118 (HLA-DQA2)    05169 Epstein-Barr virus infection     3118 (HLA-DQA2)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3118 (HLA-DQA2)    05152 Tuberculosis     3118 (HLA-DQA2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3118 (HLA-DQA2)    05140 Leishmaniasis     3118 (HLA-DQA2)   09163 Immune disease    05310 Asthma     3118 (HLA-DQA2)    05322 Systemic lupus erythematosus     3118 (HLA-DQA2)    05323 Rheumatoid arthritis     3118 (HLA-DQA2)    05320 Autoimmune thyroid disease     3118 (HLA-DQA2)    05321 Inflammatory bowel disease     3118 (HLA-DQA2)    05330 Allograft rejection     3118 (HLA-DQA2)    05332 Graft-versus-host disease     3118 (HLA-DQA2)   09166 Cardiovascular disease    05416 Viral myocarditis     3118 (HLA-DQA2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3118 (HLA-DQA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3118 (HLA-DQA2) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3118 (HLA-DQA2)   Exosomal proteins of epithelial cells    3118 (HLA-DQA2)   Exosomal proteins of breast milk    3118 (HLA-DQA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set C2-set_2 Ig_3 WW Motif Other DBs NCBI-GeneID:  3118 NCBI-ProteinID:  NP_064440 OMIM:  613503 HGNC:  4943 Ensembl:  ENSG00000237541 UniProt:  P01906 Q76NI6 LinkDB All DBs Position 6:32741391..32747198 Genome browser AA seq 255 aa AA seqDB search MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK FPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFII QGLRSVGASRHQGLL NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc tgtggaggtgaagacattgtggctgaccatgttgcctcctatggtgtgaacttctaccag tctcacggtccctctggccagtacacccatgaatttgatggagacgaggagttctatgtg gacctggagacgaaagagactgtctggcagttgcctatgtttagcaaatttataagtttt gacccgcagagtgcactgagaaatatggctgtgggaaaacacaccttggaattcatgatg agacagtccaactctaccgctgccaccaatgaggttcctgaggtcacagtgttttccaag tttcctgtgacgctgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct cctgtggtcaacatcacctggctgagcaatgggcactcagtcacagaaggtgtttctgag accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggacgagcctctt ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactttggtc tgcgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc caaggcctgcgttcagttggtgcttccagacaccaagggctcttatga

Homo sapiens (human): 3119 Help Entry 3119              CDS       T01001                                  Symbol HLA-DQB1, CELIAC1, HLA-DQB, IDDM1 Name (RefSeq) major histocompatibility complex, class II, DQ beta 1   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00079   Asthma H00080   Systemic lupus erythematosus H00294   Dilated cardiomyopathy H00342   Tuberculosis H00408   Type 1 diabetes mellitus H01362   Dermatitis herpetiformis H01490   Multiple sclerosis H02123   Celiac disease Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3119 (HLA-DQB1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3119 (HLA-DQB1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3119 (HLA-DQB1)    04612 Antigen processing and presentation     3119 (HLA-DQB1)    04658 Th1 and Th2 cell differentiation     3119 (HLA-DQB1)    04659 Th17 cell differentiation     3119 (HLA-DQB1)    04672 Intestinal immune network for IgA production     3119 (HLA-DQB1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3119 (HLA-DQB1)    05164 Influenza A     3119 (HLA-DQB1)    05168 Herpes simplex virus 1 infection     3119 (HLA-DQB1)    05169 Epstein-Barr virus infection     3119 (HLA-DQB1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3119 (HLA-DQB1)    05152 Tuberculosis     3119 (HLA-DQB1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3119 (HLA-DQB1)    05140 Leishmaniasis     3119 (HLA-DQB1)   09163 Immune disease    05310 Asthma     3119 (HLA-DQB1)    05322 Systemic lupus erythematosus     3119 (HLA-DQB1)    05323 Rheumatoid arthritis     3119 (HLA-DQB1)    05320 Autoimmune thyroid disease     3119 (HLA-DQB1)    05321 Inflammatory bowel disease     3119 (HLA-DQB1)    05330 Allograft rejection     3119 (HLA-DQB1)    05332 Graft-versus-host disease     3119 (HLA-DQB1)   09166 Cardiovascular disease    05416 Viral myocarditis     3119 (HLA-DQB1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3119 (HLA-DQB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3119 (HLA-DQB1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3119 (HLA-DQB1)   Exosomal proteins of epithelial cells    3119 (HLA-DQB1)   Exosomal proteins of breast milk    3119 (HLA-DQB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 C2-set_2 ig Ig_2 Marek_A Motif Other DBs NCBI-GeneID:  3119 NCBI-ProteinID:  NP_001230891 OMIM:  604305 HGNC:  4944 Ensembl:  ENSG00000179344 UniProt:  P01920 Q5Y7D3 Structure PDB LinkDB All DBs Position 6:complement(32659467..32666657) Genome browser AA seq 261 aa AA seqDB search MSWKKALRIPGGLRAATVTLMLSMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVS RSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELR TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLI RNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL GLIFLGLGLIIHHRSQKGLLH NT seq 786 nt NT seq  +upstreamnt  +downstreamnt atgtcttggaaaaaggctttgcggatccccggaggccttcgggcagcaactgtgaccttg atgctgtcgatgctgagcaccccagtggctgagggcagagactctcccgaggatttcgtg taccagtttaagggcatgtgctacttcaccaacgggacagagcgcgtgcgtcttgtgagc agaagcatctataaccgagaagagatcgtgcgcttcgacagcgacgtgggggagttccgg gcggtgacgctgctggggctgcctgccgccgagtactggaacagccagaaggacatcctg gagaggaaacgggcggcggtggacagggtgtgcagacacaactaccagttggagctccgc acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccagcccagatcaaa gtccggtggtttcggaatgaccaggaggagacagctggcgttgtgtccaccccccttatt aggaatggtgactggaccttccagatcctggtgatgctggaaatgactccccagcgtgga gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggcttcgtgctg gggctgatcttcctcgggctgggccttatcatccatcacaggagtcagaaagggctcctg cactga

Homo sapiens (human): 3122 Help Entry 3122              CDS       T01001                                  Symbol HLA-DRA, HLA-DRA1 Name (RefSeq) major histocompatibility complex, class II, DR alpha   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3122 (HLA-DRA)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3122 (HLA-DRA)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3122 (HLA-DRA)    04612 Antigen processing and presentation     3122 (HLA-DRA)    04658 Th1 and Th2 cell differentiation     3122 (HLA-DRA)    04659 Th17 cell differentiation     3122 (HLA-DRA)    04672 Intestinal immune network for IgA production     3122 (HLA-DRA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3122 (HLA-DRA)    05164 Influenza A     3122 (HLA-DRA)    05168 Herpes simplex virus 1 infection     3122 (HLA-DRA)    05169 Epstein-Barr virus infection     3122 (HLA-DRA)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3122 (HLA-DRA)    05152 Tuberculosis     3122 (HLA-DRA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3122 (HLA-DRA)    05140 Leishmaniasis     3122 (HLA-DRA)   09163 Immune disease    05310 Asthma     3122 (HLA-DRA)    05322 Systemic lupus erythematosus     3122 (HLA-DRA)    05323 Rheumatoid arthritis     3122 (HLA-DRA)    05320 Autoimmune thyroid disease     3122 (HLA-DRA)    05321 Inflammatory bowel disease     3122 (HLA-DRA)    05330 Allograft rejection     3122 (HLA-DRA)    05332 Graft-versus-host disease     3122 (HLA-DRA)   09166 Cardiovascular disease    05416 Viral myocarditis     3122 (HLA-DRA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3122 (HLA-DRA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3122 (HLA-DRA) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3122 (HLA-DRA)   Exosomal proteins of epithelial cells    3122 (HLA-DRA)   Exosomal proteins of breast milk    3122 (HLA-DRA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_alpha C1-set Ig_3 Ig_2 C2-set_2 Motif Other DBs NCBI-GeneID:  3122 NCBI-ProteinID:  NP_061984 OMIM:  142860 HGNC:  4947 Ensembl:  ENSG00000204287 UniProt:  P01903 A0A0G2JMH6 Structure PDB LinkDB All DBs Position 6:32439887..32445046 Genome browser AA seq 254 aa AA seqDB search MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS PVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK GLRKSNAAERRGPL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggccataagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc cctgtggaactgagagagcccaacgtcctcatctgtttcatagacaagttcaccccacca gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc tcaactgaggacgtttacgactgcagggtggagcactggggcttggatgagcctcttctc aagcactgggagtttgatgctccaagccctctcccagagactacagagaacgtggtgtgt gccctgggcctgactgtgggtctggtgggcatcattattgggaccatcttcatcatcaag ggattgcgcaaaagcaatgcagcagaacgcagggggcctctgtaa

Homo sapiens (human): 3123 Help Entry 3123              CDS       T01001                                  Symbol HLA-DRB1, DRB1, HLA-DR1B, HLA-DRB, SS1 Name (RefSeq) major histocompatibility complex, class II, DR beta 1   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H00079   Asthma H00080   Systemic lupus erythematosus H00294   Dilated cardiomyopathy H00342   Tuberculosis H00408   Type 1 diabetes mellitus H00630   Rheumatoid arthritis H01490   Multiple sclerosis H01504   Vogt-Koyanagi-Harada syndrome Drug target Apolizumab:  D02967 Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3123 (HLA-DRB1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3123 (HLA-DRB1)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3123 (HLA-DRB1)    04612 Antigen processing and presentation     3123 (HLA-DRB1)    04658 Th1 and Th2 cell differentiation     3123 (HLA-DRB1)    04659 Th17 cell differentiation     3123 (HLA-DRB1)    04672 Intestinal immune network for IgA production     3123 (HLA-DRB1)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3123 (HLA-DRB1)    05164 Influenza A     3123 (HLA-DRB1)    05168 Herpes simplex virus 1 infection     3123 (HLA-DRB1)    05169 Epstein-Barr virus infection     3123 (HLA-DRB1)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3123 (HLA-DRB1)    05152 Tuberculosis     3123 (HLA-DRB1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3123 (HLA-DRB1)    05140 Leishmaniasis     3123 (HLA-DRB1)   09163 Immune disease    05310 Asthma     3123 (HLA-DRB1)    05322 Systemic lupus erythematosus     3123 (HLA-DRB1)    05323 Rheumatoid arthritis     3123 (HLA-DRB1)    05320 Autoimmune thyroid disease     3123 (HLA-DRB1)    05321 Inflammatory bowel disease     3123 (HLA-DRB1)    05330 Allograft rejection     3123 (HLA-DRB1)    05332 Graft-versus-host disease     3123 (HLA-DRB1)   09166 Cardiovascular disease    05416 Viral myocarditis     3123 (HLA-DRB1)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3123 (HLA-DRB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3123 (HLA-DRB1) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3123 (HLA-DRB1)   Exosomal proteins of epithelial cells    3123 (HLA-DRB1)   Exosomal proteins of breast milk    3123 (HLA-DRB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2 I-set DUF202 Motif Other DBs NCBI-GeneID:  3123 NCBI-ProteinID:  NP_001230894 OMIM:  142857 HGNC:  4948 Ensembl:  ENSG00000196126 UniProt:  P01911 Q5Y7D1 Structure PDB LinkDB All DBs Position 6:complement(32578775..32589848) Genome browser AA seq 266 aa AA seqDB search MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYF HNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTV QRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPRGFLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggagtactct acgtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc cataaccaggaggagaacgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg gagctggggcggcctgatgccgagtactggaacagccagaaggacctcctggagcagaag cggggccgggtggacaactactgcagacacaactacggggttgtggagagcttcacagtg cagcggcgagtccatcctaaggtgactgtgtatccttcaaagacccagcccctgcagcac cataacctcctggtctgttctgtgagtggtttctatccaggcagcattgaagtcaggtgg ttccggaatggccaggaagagaagactggggtggtgtccacaggcctgatccacaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag ccaagaggattcctgagctga

Homo sapiens (human): 3125 Help Entry 3125              CDS       T01001                                  Symbol HLA-DRB3, DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3* Name (RefSeq) major histocompatibility complex, class II, DR beta 3   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Drug target Apolizumab:  D02967 Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3125 (HLA-DRB3)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3125 (HLA-DRB3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3125 (HLA-DRB3)    04612 Antigen processing and presentation     3125 (HLA-DRB3)    04658 Th1 and Th2 cell differentiation     3125 (HLA-DRB3)    04659 Th17 cell differentiation     3125 (HLA-DRB3)    04672 Intestinal immune network for IgA production     3125 (HLA-DRB3)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3125 (HLA-DRB3)    05164 Influenza A     3125 (HLA-DRB3)    05168 Herpes simplex virus 1 infection     3125 (HLA-DRB3)    05169 Epstein-Barr virus infection     3125 (HLA-DRB3)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3125 (HLA-DRB3)    05152 Tuberculosis     3125 (HLA-DRB3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3125 (HLA-DRB3)    05140 Leishmaniasis     3125 (HLA-DRB3)   09163 Immune disease    05310 Asthma     3125 (HLA-DRB3)    05322 Systemic lupus erythematosus     3125 (HLA-DRB3)    05323 Rheumatoid arthritis     3125 (HLA-DRB3)    05320 Autoimmune thyroid disease     3125 (HLA-DRB3)    05321 Inflammatory bowel disease     3125 (HLA-DRB3)    05330 Allograft rejection     3125 (HLA-DRB3)    05332 Graft-versus-host disease     3125 (HLA-DRB3)   09166 Cardiovascular disease    05416 Viral myocarditis     3125 (HLA-DRB3)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3125 (HLA-DRB3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3125 (HLA-DRB3) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3125 (HLA-DRB3)   Exosomal proteins of epithelial cells    3125 (HLA-DRB3)   Exosomal proteins of breast milk    3125 (HLA-DRB3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 I-set DUF202 C2-set_2 Motif Other DBs NCBI-GeneID:  3125 NCBI-ProteinID:  NP_072049 OMIM:  612735 HGNC:  4951 UniProt:  P79483 A0A4D6G1L1 Structure PDB LinkDB All DBs Position 6p21.3 Genome browser AA seq 266 aa AA seqDB search MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYF HNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV QRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgaagctccctggaggctccagcttggcagcgttgacagtgacactgatg gtgctgagctcccgactggctttcgctggggacacccgaccacgtttcttggagctgcgt aagtctgagtgtcatttcttcaatgggacggagcgggtgcggtacctggacagatacttc cataaccaggaggagttcctgcgcttcgacagcgacgtgggggagtaccgggcggtgacg gagctggggcggcctgtcgccgagtcctggaacagccagaaggacctcctggagcagaag cggggccgggtggacaattactgcagacacaactacggggttggtgagagcttcacagtg cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg ttccggaacggccaggaagagaaggctggggtggtgtccacgggcctgatccagaatgga gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac acttgccaagtggagcacccaagcgtaacgagcgctctcacagtggaatggagagcacgg tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag ccaacaggattcctgagctga

Homo sapiens (human): 3126 Help Entry 3126              CDS       T01001                                  Symbol HLA-DRB4, DR4, DRB4, HLA-DR4B, HLA-DRB, HLA-DRB4* Name (RefSeq) major histocompatibility complex, class II, DR beta 4   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H01504   Vogt-Koyanagi-Harada syndrome Drug target Apolizumab:  D02967 Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3126 (HLA-DRB4)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3126 (HLA-DRB4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3126 (HLA-DRB4)    04612 Antigen processing and presentation     3126 (HLA-DRB4)    04658 Th1 and Th2 cell differentiation     3126 (HLA-DRB4)    04659 Th17 cell differentiation     3126 (HLA-DRB4)    04672 Intestinal immune network for IgA production     3126 (HLA-DRB4)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3126 (HLA-DRB4)    05164 Influenza A     3126 (HLA-DRB4)    05168 Herpes simplex virus 1 infection     3126 (HLA-DRB4)    05169 Epstein-Barr virus infection     3126 (HLA-DRB4)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3126 (HLA-DRB4)    05152 Tuberculosis     3126 (HLA-DRB4)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3126 (HLA-DRB4)    05140 Leishmaniasis     3126 (HLA-DRB4)   09163 Immune disease    05310 Asthma     3126 (HLA-DRB4)    05322 Systemic lupus erythematosus     3126 (HLA-DRB4)    05323 Rheumatoid arthritis     3126 (HLA-DRB4)    05320 Autoimmune thyroid disease     3126 (HLA-DRB4)    05321 Inflammatory bowel disease     3126 (HLA-DRB4)    05330 Allograft rejection     3126 (HLA-DRB4)    05332 Graft-versus-host disease     3126 (HLA-DRB4)   09166 Cardiovascular disease    05416 Viral myocarditis     3126 (HLA-DRB4)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3126 (HLA-DRB4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3126 (HLA-DRB4) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3126 (HLA-DRB4)   Exosomal proteins of epithelial cells    3126 (HLA-DRB4)   Exosomal proteins of breast milk    3126 (HLA-DRB4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 DUF202 Motif Other DBs NCBI-GeneID:  3126 NCBI-ProteinID:  NP_068818 HGNC:  4952 UniProt:  P13762 X5D2U9 LinkDB All DBs Position 6p21.3 Genome browser AA seq 266 aa AA seqDB search MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYI YNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLL FLGTGLFIYFRNQKGHSGLQPTGLLS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgaagctccctggaggctcctgtatggcagcgctgacagtgacattgacg gtgctgagctccccactggctttggctggggacacccaaccacgtttcttggagcaggct aagtgtgagtgtcatttcctcaatgggacggagcgagtgtggaacctgatcagatacatc tataaccaagaggagtacgcgcgctacaacagtgacctgggggagtaccaggcggtgacg gagctggggcggcctgacgctgagtactggaacagccagaaggacctcctggagcggagg cgggccgaggtggacacctactgcagatacaactacggggttgtggagagcttcacagtg cagcggcgagtccaacctaaggtgactgtgtatccttcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg ttccggaacggccaggaagagaaggctggggtggtgtccacaggcctgatccagaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcggagtggagaggtttac acctgccaagtggagcatccaagcatgatgagccctctcacggtgcaatggagtgcacgg tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttgggacagggctgttcatctacttcaggaatcagaaaggacactctggacttcag ccaacaggactcttgagctga

Homo sapiens (human): 3127 Help Entry 3127              CDS       T01001                                  Symbol HLA-DRB5, DRB5, HLA-DRB5* Name (RefSeq) major histocompatibility complex, class II, DR beta 5   KO K06752   MHC class II antigen Organism hsa  Homo sapiens (human) Pathway hsa04145   Phagosome hsa04514   Cell adhesion molecules hsa04612   Antigen processing and presentation hsa04640   Hematopoietic cell lineage hsa04658   Th1 and Th2 cell differentiation hsa04659   Th17 cell differentiation hsa04672   Intestinal immune network for IgA production hsa04940   Type I diabetes mellitus hsa05140   Leishmaniasis hsa05145   Toxoplasmosis hsa05150   Staphylococcus aureus infection hsa05152   Tuberculosis hsa05164   Influenza A hsa05166   Human T-cell leukemia virus 1 infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05310   Asthma hsa05320   Autoimmune thyroid disease hsa05321   Inflammatory bowel disease hsa05322   Systemic lupus erythematosus hsa05323   Rheumatoid arthritis hsa05330   Allograft rejection hsa05332   Graft-versus-host disease hsa05416   Viral myocarditis Network nt06160  Human T-cell leukemia virus 1 (HTLV-1) nt06168  Herpes simplex virus 1 (HSV-1)   Element N00508   HTLV-1 Tax to NFY-mediated transcription N00590   Antigen processing and presentation by MHC class II molecules Disease H02424   Primary central nervous system lymphoma Drug target Apolizumab:  D02967 Glatiramer acetate:  D04318<JP/US> Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     3127 (HLA-DRB5)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     3127 (HLA-DRB5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     3127 (HLA-DRB5)    04612 Antigen processing and presentation     3127 (HLA-DRB5)    04658 Th1 and Th2 cell differentiation     3127 (HLA-DRB5)    04659 Th17 cell differentiation     3127 (HLA-DRB5)    04672 Intestinal immune network for IgA production     3127 (HLA-DRB5)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     3127 (HLA-DRB5)    05164 Influenza A     3127 (HLA-DRB5)    05168 Herpes simplex virus 1 infection     3127 (HLA-DRB5)    05169 Epstein-Barr virus infection     3127 (HLA-DRB5)   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     3127 (HLA-DRB5)    05152 Tuberculosis     3127 (HLA-DRB5)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     3127 (HLA-DRB5)    05140 Leishmaniasis     3127 (HLA-DRB5)   09163 Immune disease    05310 Asthma     3127 (HLA-DRB5)    05322 Systemic lupus erythematosus     3127 (HLA-DRB5)    05323 Rheumatoid arthritis     3127 (HLA-DRB5)    05320 Autoimmune thyroid disease     3127 (HLA-DRB5)    05321 Inflammatory bowel disease     3127 (HLA-DRB5)    05330 Allograft rejection     3127 (HLA-DRB5)    05332 Graft-versus-host disease     3127 (HLA-DRB5)   09166 Cardiovascular disease    05416 Viral myocarditis     3127 (HLA-DRB5)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     3127 (HLA-DRB5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     3127 (HLA-DRB5) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    3127 (HLA-DRB5)   Exosomal proteins of epithelial cells    3127 (HLA-DRB5)   Exosomal proteins of breast milk    3127 (HLA-DRB5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MHC_II_beta C1-set Ig_3 ig Ig_2 Motif Other DBs NCBI-GeneID:  3127 NCBI-ProteinID:  NP_002116 OMIM:  604776 HGNC:  4953 Ensembl:  ENSG00000198502 UniProt:  Q30154 A0A2Z4LKS3 Structure PDB LinkDB All DBs Position 6:complement(32517353..32530287) Genome browser AA seq 266 aa AA seqDB search MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDI YNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTV QRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKMLSGVGGFVLGLL FLGAGLFIYFKNQKGHSGLHPTGLVS NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atggtgtgtctgaagctccctggaggttcctacatggcaaagctgacagtgacactgatg gtgctgagctccccactggctttggctggggacacccgaccacgtttcttgcagcaggat aagtatgagtgtcatttcttcaacgggacggagcgggtgcggttcctgcacagagacatc tataaccaagaggaggacttgcgcttcgacagcgacgtgggggagtaccgggcggtgacg gagctggggcggcctgacgctgagtactggaacagccagaaggacttcctggaagacagg cgcgccgcggtggacacctactgcagacacaactacggggttggtgagagcttcacagtg cagcggcgagttgagcctaaggtgactgtgtatcctgcaaggacccagaccctgcagcac cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg ttccggaacagccaggaagagaaggctggggtggtgtccacaggcctgattcagaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac acctgccaagtggagcacccaagcgtgacgagccctctcacagtggaatggagagcacag tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttggggccgggctattcatctacttcaagaatcagaaagggcactctggacttcac ccaacaggactcgtgagctga

DBGET integrated database retrieval system