Homo sapiens (human): 4535 Help Entry 4535              CDS       T01001                                  Symbol ND1, MTND1, MT-ND1 Name (RefSeq) NADH dehydrogenase subunit 1   KO K03878   NADH-ubiquinone oxidoreductase chain 1 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00068   Leber hereditary optic atrophy H00473   Mitochondrial complex I deficiency H01347   MELAS syndrome H01365   Leber hereditary optic neuropathy and dystonia Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4535 (ND1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4535 (ND1)   09159 Environmental adaptation    04714 Thermogenesis     4535 (ND1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4535 (ND1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4535 (ND1)    05012 Parkinson disease     4535 (ND1)    05014 Amyotrophic lateral sclerosis     4535 (ND1)    05016 Huntington disease     4535 (ND1)    05020 Prion disease     4535 (ND1)    05022 Pathways of neurodegeneration - multiple diseases     4535 (ND1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4535 (ND1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4535 (ND1) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4535 (ND1) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4535 (ND1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NADHdh Motif Other DBs NCBI-GeneID:  4535 NCBI-ProteinID:  YP_003024026 OMIM:  516000 HGNC:  7455 UniProt:  P03886 U5Z754 Structure PDB LinkDB All DBs Position MT:3307..4262 Genome browser AA seq 318 aa AA seqDB search MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL LMWYVSMPITISSIPPQT NT seq 956 nt NT seq  +upstreamnt  +downstreamnt atacccatggccaacctcctactcctcattgtacccattctaatcgcaatggcattccta atgcttaccgaacgaaaaattctaggctatatacaactacgcaaaggccccaacgttgta ggcccctacgggctactacaacccttcgctgacgccataaaactcttcaccaaagagccc ctaaaacccgccacatctaccatcaccctctacatcaccgccccgaccttagctctcacc atcgctcttctactatgaacccccctccccatacccaaccccctggtcaacctcaaccta ggcctcctatttattctagccacctctagcctagccgtttactcaatcctctgatcaggg tgagcatcaaactcaaactacgccctgatcggcgcactgcgagcagtagcccaaacaatc tcatatgaagtcaccctagccatcattctactatcaacattactaataagtggctccttt aacctctccacccttatcacaacacaagaacacctctgattactcctgccatcatgaccc ttggccataatatgatttatctccacactagcagagaccaaccgaacccccttcgacctt gccgaaggggagtccgaactagtctcaggcttcaacatcgaatacgccgcaggccccttc gccctattcttcatagccgaatacacaaacattattataataaacaccctcaccactaca atcttcctaggaacaacatatgacgcactctcccctgaactctacacaacatattttgtc accaagaccctacttctaacctccctgttcttatgaattcgaacagcatacccccgattc cgctacgaccaactcatacacctcctatgaaaaaacttcctaccactcaccctagcatta cttatatgatatgtctccatacccattacaatctccagcattccccctcaaaccta

Homo sapiens (human): 4536 Help Entry 4536              CDS       T01001                                  Symbol ND2, MTND2, MT-ND2 Name (RefSeq) NADH dehydrogenase subunit 2   KO K03879   NADH-ubiquinone oxidoreductase chain 2 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00068   Leber hereditary optic atrophy H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4536 (ND2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4536 (ND2)   09159 Environmental adaptation    04714 Thermogenesis     4536 (ND2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4536 (ND2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4536 (ND2)    05012 Parkinson disease     4536 (ND2)    05014 Amyotrophic lateral sclerosis     4536 (ND2)    05016 Huntington disease     4536 (ND2)    05020 Prion disease     4536 (ND2)    05022 Pathways of neurodegeneration - multiple diseases     4536 (ND2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4536 (ND2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4536 (ND2) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4536 (ND2) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4536 (ND2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proton_antipo_M NADH_dehy_S2_C Motif Other DBs NCBI-GeneID:  4536 NCBI-ProteinID:  YP_003024027 OMIM:  516001 HGNC:  7456 UniProt:  P03891 Q7GXY9 Structure PDB LinkDB All DBs Position MT:4470..5511 Genome browser AA seq 347 aa AA seqDB search MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYF LTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQ GTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILA YSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWL TPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL NT seq 1042 nt NT seq  +upstreamnt  +downstreamnt attaatcccctggcccaacccgtcatctactctaccatctttgcaggcacactcatcaca gcgctaagctcgcactgattttttacctgagtaggcctagaaataaacatgctagctttt attccagttctaaccaaaaaaataaaccctcgttccacagaagctgccatcaagtatttc ctcacgcaagcaaccgcatccataatccttctaatagctatcctcttcaacaatatactc tccggacaatgaaccataaccaatactaccaatcaatactcatcattaataatcataata gctatagcaataaaactaggaatagccccctttcacttctgagtcccagaggttacccaa ggcacccctctgacatccggcctgcttcttctcacatgacaaaaactagcccccatctca atcatataccaaatctctccctcactaaacgtaagccttctcctcactctctcaatctta tccatcatagcaggcagttgaggtggattaaaccaaacccagctacgcaaaatcttagca tactcctcaattacccacataggatgaataatagcagttctaccgtacaaccctaacata accattcttaatttaactatttatattatcctaactactaccgcattcctactactcaac ttaaactccagcaccacgaccctactactatctcgcacctgaaacaagctaacatgacta acacccttaattccatccaccctcctctccctaggaggcctgcccccgctaaccggcttt ttgcccaaatgggccattatcgaagaattcacaaaaaacaatagcctcatcatccccacc atcatagccaccatcaccctccttaacctctacttctacctacgcctaatctactccacc tcaatcacactactccccatatctaacaacgtaaaaataaaatgacagtttgaacataca aaacccaccccattcctccccacactcatcgcccttaccacgctactcctacctatctcc ccttttatactaataatcttat

Homo sapiens (human): 4537 Help Entry 4537              CDS       T01001                                  Symbol ND3, MTND3, MT-ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00473   Mitochondrial complex I deficiency H01355   Kearns-Sayre syndrome H01365   Leber hereditary optic neuropathy and dystonia Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4537 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4537 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     4537 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4537 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4537 (ND3)    05012 Parkinson disease     4537 (ND3)    05014 Amyotrophic lateral sclerosis     4537 (ND3)    05016 Huntington disease     4537 (ND3)    05020 Prion disease     4537 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     4537 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4537 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4537 (ND3) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4537 (ND3) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4537 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 SHP Motif Other DBs NCBI-GeneID:  4537 NCBI-ProteinID:  YP_003024033 OMIM:  516002 HGNC:  7458 UniProt:  P03897 Q7GXZ5 Structure PDB LinkDB All DBs Position MT:10059..10404 Genome browser AA seq 115 aa AA seqDB search MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE NT seq 346 nt NT seq  +upstreamnt  +downstreamnt ataaacttcgccttaattttaataatcaacaccctcctagccttactactaataattatt acattttgactaccacaactcaacggctacatagaaaaatccaccccttacgagtgcggc ttcgaccctatatcccccgcccgcgtccctttctccataaaattcttcttagtagctatt accttcttattatttgatctagaaattgccctccttttacccctaccatgagccctacaa acaactaacctgccactaatagttatgtcatccctcttattaatcatcatcctagcccta agtctggcctatgagtgactacaaaaaggattagactgaaccgaat

Homo sapiens (human): 4538 Help Entry 4538              CDS       T01001                                  Symbol ND4, MTND4, MT-ND4, LHON Name (RefSeq) NADH dehydrogenase subunit 4   KO K03881   NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00068   Leber hereditary optic atrophy H00473   Mitochondrial complex I deficiency H01355   Kearns-Sayre syndrome H01365   Leber hereditary optic neuropathy and dystonia Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4538 (ND4)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4538 (ND4)   09159 Environmental adaptation    04714 Thermogenesis     4538 (ND4)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4538 (ND4)   09164 Neurodegenerative disease    05010 Alzheimer disease     4538 (ND4)    05012 Parkinson disease     4538 (ND4)    05014 Amyotrophic lateral sclerosis     4538 (ND4)    05016 Huntington disease     4538 (ND4)    05020 Prion disease     4538 (ND4)    05022 Pathways of neurodegeneration - multiple diseases     4538 (ND4)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4538 (ND4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4538 (ND4) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4538 (ND4) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4538 (ND4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proton_antipo_M Oxidored_q5_N Motif Other DBs NCBI-GeneID:  4538 NCBI-ProteinID:  YP_003024035 OMIM:  516003 HGNC:  7459 UniProt:  P03905 H9EC08 Structure PDB LinkDB All DBs Position MT:10760..12137 Genome browser AA seq 459 aa AA seqDB search MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS NT seq 1378 nt NT seq  +upstreamnt  +downstreamnt atgctaaaactaatcgtcccaacaattatattactaccactgacatgactttccaaaaaa cacataatttgaatcaacacaaccacccacagcctaattattagcatcatccctctacta ttttttaaccaaatcaacaacaacctatttagctgttccccaaccttttcctccgacccc ctaacaacccccctcctaatactaactacctgactcctacccctcacaatcatggcaagc caacgccacttatccagtgaaccactatcacgaaaaaaactctacctctctatactaatc tccctacaaatctccttaattataacattcacagccacagaactaatcatattttatatc ttcttcgaaaccacacttatccccaccttggctatcatcacccgatgaggcaaccagcca gaacgcctgaacgcaggcacatacttcctattctacaccctagtaggctcccttccccta ctcatcgcactaatttacactcacaacaccctaggctcactaaacattctactactcact ctcactgcccaagaactatcaaactcctgagccaacaacttaatatgactagcttacaca atagcttttatagtaaagatacctctttacggactccacttatgactccctaaagcccat gtcgaagcccccatcgctgggtcaatagtacttgccgcagtactcttaaaactaggcggc tatggtataatacgcctcacactcattctcaaccccctgacaaaacacatagcctacccc ttccttgtactatccctatgaggcataattataacaagctccatctgcctacgacaaaca gacctaaaatcgctcattgcatactcttcaatcagccacatagccctcgtagtaacagcc attctcatccaaaccccctgaagcttcaccggcgcagtcattctcataatcgcccacggg cttacatcctcattactattctgcctagcaaactcaaactacgaacgcactcacagtcgc atcataatcctctctcaaggacttcaaactctactcccactaatagctttttgatgactt ctagcaagcctcgctaacctcgccttaccccccactattaacctactgggagaactctct gtgctagtaaccacgttctcctgatcaaatatcactctcctacttacaggactcaacata ctagtcacagccctatactccctctacatatttaccacaacacaatggggctcactcacc caccacattaacaacataaaaccctcattcacacgagaaaacaccctcatgttcatacac ctatcccccattctcctcctatccctcaaccccgacatcattaccgggttttcctctt

Homo sapiens (human): 4540 Help Entry 4540              CDS       T01001                                  Symbol ND5, MTND5, MT-ND5 Name (RefSeq) NADH dehydrogenase subunit 5   KO K03883   NADH-ubiquinone oxidoreductase chain 5 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00068   Leber hereditary optic atrophy H00473   Mitochondrial complex I deficiency H01347   MELAS syndrome H01355   Kearns-Sayre syndrome H01356   Myoclonic Epilepsy and Ragged-Red Fiber Disease Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4540 (ND5)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4540 (ND5)   09159 Environmental adaptation    04714 Thermogenesis     4540 (ND5)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4540 (ND5)   09164 Neurodegenerative disease    05010 Alzheimer disease     4540 (ND5)    05012 Parkinson disease     4540 (ND5)    05014 Amyotrophic lateral sclerosis     4540 (ND5)    05016 Huntington disease     4540 (ND5)    05020 Prion disease     4540 (ND5)    05022 Pathways of neurodegeneration - multiple diseases     4540 (ND5)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4540 (ND5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4540 (ND5) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4540 (ND5) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4540 (ND5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proton_antipo_M NADH5_C Proton_antipo_N Motif Other DBs NCBI-GeneID:  4540 NCBI-ProteinID:  YP_003024036 OMIM:  516005 HGNC:  7461 UniProt:  P03915 U5ZC31 Structure PDB LinkDB All DBs Position MT:12337..14148 Genome browser AA seq 603 aa AA seqDB search MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQE VIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKY LLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDI GFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGP TPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKK IVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMG GLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTS AYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQT TIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYL GLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL LIT NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt ataaccatgcacactactataaccaccctaaccctgacttccctaattccccccatcctt accaccctcgttaaccctaacaaaaaaaactcatacccccattatgtaaaatccattgtc gcatccacctttattatcagtctcttccccacaacaatattcatgtgcctagaccaagaa gttattatctcgaactgacactgagccacaacccaaacaacccagctctccctaagcttc aaactagactacttctccataatattcatccctgtagcattgttcgttacatggtccatc atagaattctcactgtgatatataaactcagacccaaacattaatcagttcttcaaatat ctactcatcttcctaattaccatactaatcttagttaccgctaacaacctattccaactg ttcatcggctgagagggcgtaggaattatatccttcttgctcatcagttgatgatacgcc cgagcagatgccaacacagcagccattcaagcaatcctatacaaccgtatcggcgatatc ggtttcatcctcgccttagcatgatttatcctacactccaactcatgagacccacaacaa atagcccttctaaacgctaatccaagcctcaccccactactaggcctcctcctagcagca gcaggcaaatcagcccaattaggtctccacccctgactcccctcagccatagaaggcccc accccagtctcagccctactccactcaagcactatagttgtagcaggaatcttcttactc atccgcttccaccccctagcagaaaatagcccactaatccaaactctaacactatgctta ggcgctatcaccactctgttcgcagcagtctgcgcccttacacaaaatgacatcaaaaaa atcgtagccttctccacttcaagtcaactaggactcataatagttacaatcggcatcaac caaccacacctagcattcctgcacatctgtacccacgccttcttcaaagccatactattt atgtgctccgggtccatcatccacaaccttaacaatgaacaagatattcgaaaaatagga ggactactcaaaaccatacctctcacttcaacctccctcaccattggcagcctagcatta gcaggaatacctttcctcacaggtttctactccaaagaccacatcatcgaaaccgcaaac atatcatacacaaacgcctgagccctatctattactctcatcgctacctccctgacaagc gcctatagcactcgaataattcttctcaccctaacaggtcaacctcgcttccccaccctt actaacattaacgaaaataaccccaccctactaaaccccattaaacgcctggcagccgga agcctattcgcaggatttctcattactaacaacatttcccccgcatcccccttccaaaca acaatccccctctacctaaaactcacagccctcgctgtcactttcctaggacttctaaca gccctagacctcaactacctaaccaacaaacttaaaataaaatccccactatgcacattt tatttctccaacatactcggattctaccctagcatcacacaccgcacaatcccctatcta ggccttcttacgagccaaaacctgcccctactcctcctagacctaacctgactagaaaag ctattacctaaaacaatttcacagcaccaaatctccacctccatcatcacctcaacccaa aaaggcataattaaactttacttcctctctttcttcttcccactcatcctaaccctactc ctaatcacataa

Homo sapiens (human): 4541 Help Entry 4541              CDS       T01001                                  Symbol ND6, MTND6, MT-ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00142   NADH:ubiquinone oxidoreductase, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Disease H00068   Leber hereditary optic atrophy H00473   Mitochondrial complex I deficiency H01347   MELAS syndrome H01355   Kearns-Sayre syndrome H01365   Leber hereditary optic neuropathy and dystonia Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4541 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4541 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     4541 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4541 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4541 (ND6)    05012 Parkinson disease     4541 (ND6)    05014 Amyotrophic lateral sclerosis     4541 (ND6)    05016 Huntington disease     4541 (ND6)    05020 Prion disease     4541 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     4541 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4541 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     4541 (ND6) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4541 (ND6) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4541 (ND6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q3 Motif Other DBs NCBI-GeneID:  4541 NCBI-ProteinID:  YP_003024037 OMIM:  516006 HGNC:  7462 UniProt:  P03923 U5Z977 Structure PDB LinkDB All DBs Position MT:complement(14149..14673) Genome browser AA seq 174 aa AA seqDB search MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYL GGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNS VGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgatgtatgctttgtttctgttgagtgtgggtttagtaatggggtttgtggggttttct tctaagccttctcctatttatgggggtttagtattgattgttagcggtgtggtcgggtgt gttattattctgaattttgggggaggttatatgggtttaatagtttttttaatttattta gggggaatgatggttgtctttggatatactacagcgatggctattgaggagtatcctgag gcatgggggtcaggggttgaggtcttggtgagtgttttagtggggttagcgatggaggta ggattggtgctgtgggtgaaagagtatgatggggtggtggttgtggtaaactttaatagt gtaggaagctgaataatttatgaaggagaggggtcagggttgattcgggaggatcctatt ggtgcgggggctttgtatgattatgggcgttgattagtagtagttactggttgaacattg tttgttggtgtatatattgtaattgagattgctcgggggaatagg

Homo sapiens (human): 4719 Help Entry 4719              CDS       T01001                                  Symbol NDUFS1, CI-75Kd, CI-75k, MC1DN5, PRO1304 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S1   KO K03934   NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4719 (NDUFS1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4719 (NDUFS1)   09159 Environmental adaptation    04714 Thermogenesis     4719 (NDUFS1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4719 (NDUFS1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4719 (NDUFS1)    05012 Parkinson disease     4719 (NDUFS1)    05014 Amyotrophic lateral sclerosis     4719 (NDUFS1)    05016 Huntington disease     4719 (NDUFS1)    05020 Prion disease     4719 (NDUFS1)    05022 Pathways of neurodegeneration - multiple diseases     4719 (NDUFS1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4719 (NDUFS1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4719 (NDUFS1) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4719 (NDUFS1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Molybdopterin Fer2_4 NADH-G_4Fe-4S_3 NADH_dhqG_C Fer2 Motif Other DBs NCBI-GeneID:  4719 NCBI-ProteinID:  NP_004997 OMIM:  157655 HGNC:  7707 Ensembl:  ENSG00000023228 UniProt:  P28331 E5KRK5 Structure PDB LinkDB All DBs Position 2:complement(206114817..206159444) Genome browser AA seq 727 aa AA seqDB search MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA VEEPSIC NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt atgttaaggatacctgtaagaaaggccttagtaggcctttctaagtctcctaaaggatgt gttcgaacaactgccacagcagcaagcaacttgattgaagtatttgttgatggtcagtct gtcatggtggaaccgggaacgaccgtcctccaagcttgtgagaaggttggcatgcagatc cctcgattctgttatcatgaaaggttgtctgttgctggaaactgcaggatgtgccttgtt gaaattgagaaagcccctaaggttgtagctgcttgtgccatgccagtaatgaagggttgg aatatcctaacaaactcagaaaaatccaaaaaagccagggaaggtgtgatggagttctta ttagcaaatcacccattggactgtcctatttgtgaccagggaggtgaatgtgatctgcag gaccagtccatgatgtttggaaatgataggagccgatttttagaggggaagcgtgctgtg gaagacaagaacattgggccattggtaaagaccatcatgacaagatgtatacagtgtact cgctgcatcaggtttgcaagtgagattgcaggagtagatgatttgggaacaacaggcaga ggaaatgatatgcaagttggcacatacattgaaaagatgttcatgtctgaactgtctggg aatatcattgatatctgccctgtaggtgccctaacctctaagccctatgcctttactgcc cggccttgggaaacaagaaagacagaatccattgatgtaatggatgcggttggaagtaat attgtggttagcacaagaactggagaagtgatgaggattttgccacgtatgcatgaggac atcaatgaagagtggatctctgataaaaccagatttgcctatgatgggctaaaacgtcaa agacttaccgagccaatggtcagaaatgaaaaagggcttttaacctatacttcttgggag gatgcgctctctcgcgtagctggaatgttgcagagttttcaaggcaaagatgtggcagca attgcaggtggcttggtggatgctgaagccctggtagctctcaaagatttgcttaataga gtggactctgacaccttatgcactgaagaggtcttccccactgcaggagctggcacagat ttgcgttccaattatcttcttaatactacaattgctggtgtggaagaggcagatgttgtt cttctggttggtacaaacccacgttttgaggcaccactgtttaatgctagaattcgaaag agctggctgcataatgacttaaaagtggcccttataggcagtccagtggacctcacttac acatatgaccacctgggagactcccccaaaattcttcaagacattgcttcgggaagccat ccatttagccaggtcctaaaggaagctaaaaaaccaatggtggttttaggcagttctgca ctccaaagaaatgatggagcagcaattcttgcagctgtttctagcattgcacaaaagatt cggatgactagtggtgttactggtgattggaaagttatgaatatccttcataggattgca agtcaagtagctgctttggaccttggctataagcctggggtggaagcaattcggaagaac cctcccaaggtgctgtttctcctgggagcagatggaggttgtatcacacgacaggatttg ccaaaggattgtttcattatttatcaaggacatcatggtgatgttggggctcccatagct gatgttattctcccaggagctgcttacacagagaagtctgctacatatgtcaacactgag ggtagagctcagcagactaaggtagcagtgacacctcctggcttggcaagagaagactgg aaaattataagagcactctctgagattgctggaatgactcttccatatgatactctggat caagtaaggaacagattggaagaagtctctcctaatcttgttcgatatgatgatattgaa ggggctaattacttccagcaagcaaatgagctctcaaagctagtgaaccagcagcttctt gctgacccacttgttccacctcagctaactataaaagacttctacatgacagattcaatt agcagagcctcacagacaatggccaaatgtgtcaaagctgtcacagagggtgcccaggca gtagaggaaccatccatatgctga

Homo sapiens (human): 4720 Help Entry 4720              CDS       T01001                                  Symbol NDUFS2, CI-49, LHONAR2, MC1DN6 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S2   KO K03935   NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4720 (NDUFS2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4720 (NDUFS2)   09159 Environmental adaptation    04714 Thermogenesis     4720 (NDUFS2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4720 (NDUFS2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4720 (NDUFS2)    05012 Parkinson disease     4720 (NDUFS2)    05014 Amyotrophic lateral sclerosis     4720 (NDUFS2)    05016 Huntington disease     4720 (NDUFS2)    05020 Prion disease     4720 (NDUFS2)    05022 Pathways of neurodegeneration - multiple diseases     4720 (NDUFS2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4720 (NDUFS2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4720 (NDUFS2) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4720 (NDUFS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_49kDa NiFeSe_Hases Motif Other DBs NCBI-GeneID:  4720 NCBI-ProteinID:  NP_004541 OMIM:  602985 HGNC:  7708 Ensembl:  ENSG00000158864 UniProt:  O75306 Structure PDB LinkDB All DBs Position 1:161197417..161214395 Genome browser AA seq 463 aa AA seqDB search MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAH WKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRL LNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL MDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQW DLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDD AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctgagggctttgtgcggcttccggggcgtcgcggcccaggtgctgcggcct ggggctggagtccgattgccgattcagcccagcagaggtgttcggcagtggcagccagat gtggaatgggcacagcagtttgggggagctgttatgtacccaagcaaagaaacagcccac tggaagcctccaccttggaatgatgtggaccctccaaaggacacaattgtgaagaacatt accctgaactttgggccccaacacccagcagcgcatggtgtcctgcgactagtgatggaa ttgagtggggagatggtgcggaagtgtgatcctcacatcgggctcctgcaccgaggcact gagaagctcattgaatacaagacctatcttcaggcccttccatactttgaccggctagac tatgtgtccatgatgtgtaacgaacaggcctattctctagctgtggagaagttgctaaac atccggcctcctcctcgggcacagtggatccgagtgctgtttggagaaatcacacgtttg ttgaaccacatcatggctgtgaccacacatgccctggaccttggggccatgacccctttc ttctggctgtttgaagaaagggagaagatgtttgagttctacgagcgagtgtctggagcc cgaatgcatgctgcttatatccggccaggaggagtgcaccaggacctaccccttgggctt atggatgacatttatcagttttctaagaacttctctcttcggcttgatgagttggaggag ttgctgaccaacaataggatctggcgaaatcggacaattgacattggggttgtaacagca gaagaagcacttaactatggttttagtggagtgatgcttcggggctcaggcatccagtgg gacctgcggaagacccagccctatgatgtttacgaccaggttgagtttgatgttcctgtt ggttctcgaggggactgctatgataggtacctgtgccgggtggaggagatgcgccagtcc ctgagaattatcgcacagtgtctaaacaagatgcctcctggggagatcaaggttgatgat gccaaagtgtctccacctaagcgagcagagatgaagacttccatggagtcactgattcat cactttaagttgtatactgagggctaccaagttcctccaggagccacatatactgccatt gaggctcccaagggagagtttggggtgtacctggtgtctgatggcagcagccgcccttat cgatgcaagatcaaggctcctggttttgcccatctggctggtttggacaagatgtctaag ggacacatgttggcagatgtcgttgccatcataggtacccaagatattgtatttggagaa gtagatcggtga

Homo sapiens (human): 4722 Help Entry 4722              CDS       T01001                                  Symbol NDUFS3, CI-30, MC1DN8 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S3   KO K03936   NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4722 (NDUFS3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4722 (NDUFS3)   09159 Environmental adaptation    04714 Thermogenesis     4722 (NDUFS3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4722 (NDUFS3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4722 (NDUFS3)    05012 Parkinson disease     4722 (NDUFS3)    05014 Amyotrophic lateral sclerosis     4722 (NDUFS3)    05016 Huntington disease     4722 (NDUFS3)    05020 Prion disease     4722 (NDUFS3)    05022 Pathways of neurodegeneration - multiple diseases     4722 (NDUFS3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4722 (NDUFS3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4722 (NDUFS3) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4722 (NDUFS3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_30kDa Motif Other DBs NCBI-GeneID:  4722 NCBI-ProteinID:  NP_004542 OMIM:  603846 HGNC:  7710 Ensembl:  ENSG00000213619 UniProt:  O75489 Structure PDB LinkDB All DBs Position 11:47579074..47584562 Genome browser AA seq 264 aa AA seqDB search MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE AFPVYRQPPESLKLEAGDKKPDAK NT seq 795 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggtagccaggctgtggtggcgcgggatcttgggggcctcggcgctg accagggggactgggcgaccctccgttctgttgctgccggtgaggcgggagagcgccggg gccgacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagct tttggagagtatgtggctgaaatcttgcccaagtatgtccaacaagttcaggtgtcctgc ttcaatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgactttcctc agggatcacaccaatgcacagttcaaatctctggttgacttgacagcagtggacgtccca actcggcaaaaccgttttgagattgtctacaacctgttgtctctgcgcttcaactcacgg atccgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctctgtgttc aaggcagccaactggtatgaaagggagatctgggacatgtttggagtcttctttgctaac caccctgatctaagaaggatcctgacagattatggcttcgagggacatcctttccggaaa gactttcctctatctggctatgttgagttacgttatgatgatgaagtgaagcgggtggtg gcagagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccctgggag gctttcccagtctatcgccaacccccggagagtctcaagcttgaagccggagacaagaag cctgatgccaagtag

Homo sapiens (human): 4724 Help Entry 4724              CDS       T01001                                  Symbol NDUFS4, AQDQ, CI-18, CI-18_kDa, CI-AQDQ, MC1DN1 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit S4   KO K03937   NADH dehydrogenase (ubiquinone) Fe-S protein 4 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4724 (NDUFS4)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4724 (NDUFS4)   09159 Environmental adaptation    04714 Thermogenesis     4724 (NDUFS4)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4724 (NDUFS4)   09164 Neurodegenerative disease    05010 Alzheimer disease     4724 (NDUFS4)    05012 Parkinson disease     4724 (NDUFS4)    05014 Amyotrophic lateral sclerosis     4724 (NDUFS4)    05016 Huntington disease     4724 (NDUFS4)    05020 Prion disease     4724 (NDUFS4)    05022 Pathways of neurodegeneration - multiple diseases     4724 (NDUFS4)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4724 (NDUFS4)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4724 (NDUFS4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUS4 CSN8_PSD8_EIF3K Motif Other DBs NCBI-GeneID:  4724 NCBI-ProteinID:  NP_002486 OMIM:  602694 HGNC:  7711 Ensembl:  ENSG00000164258 UniProt:  O43181 A0A0S2Z433 Structure PDB LinkDB All DBs Position 5:53560639..53683338 Genome browser AA seq 175 aa AA seqDB search MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLD ITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP LSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggcggcggtgtcaatgtcagtggtactgaggcagacgttgtggcggagaagggcagtg gctgtagctgccctttccgtttccagggttccgaccaggtcgttgaggacttccacatgg agattggcacaggaccagactcaagacacacaactcataacagttgatgaaaaattggat atcactactttaactggagttccagaagagcatataaaaactagaaaagtcaggatcttt gttcctgctcgcaataacatgcagtctggagtaaacaacacaaagaaatggaagatggag tttgataccagagagcgatgggaaaatcctttgatgggttgggcatcaacggctgatccc ttatccaacatggttctaaccttcagtactaaagaagatgcagtttcctttgcagaaaaa aatggatggagctatgacattgaagagaggaaggttccaaaacccaagtccaagtcttat ggtgcaaacttttcttggaacaaaagaacaagagtatccacaaaatag

Homo sapiens (human): 4725 Help Entry 4725              CDS       T01001                                  Symbol NDUFS5, CI-15k, CI15K Name (RefSeq) NADH:ubiquinone oxidoreductase subunit S5   KO K03938   NADH dehydrogenase (ubiquinone) Fe-S protein 5 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4725 (NDUFS5)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4725 (NDUFS5)   09159 Environmental adaptation    04714 Thermogenesis     4725 (NDUFS5)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4725 (NDUFS5)   09164 Neurodegenerative disease    05010 Alzheimer disease     4725 (NDUFS5)    05012 Parkinson disease     4725 (NDUFS5)    05014 Amyotrophic lateral sclerosis     4725 (NDUFS5)    05016 Huntington disease     4725 (NDUFS5)    05020 Prion disease     4725 (NDUFS5)    05022 Pathways of neurodegeneration - multiple diseases     4725 (NDUFS5)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4725 (NDUFS5)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4725 (NDUFS5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ndufs5 Cmc1 Motif Other DBs NCBI-GeneID:  4725 NCBI-ProteinID:  NP_001171908 OMIM:  603847 HGNC:  7712 Ensembl:  ENSG00000168653 UniProt:  O43920 Q6IBA0 Structure PDB LinkDB All DBs Position 1:39026350..39034615 Genome browser AA seq 106 aa AA seqDB search MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEY DDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcctttcttggacatccagaaaaggttcggccttaacatagatcgatggttgacaatc cagagtggtgaacagccctacaagatggctggtcgatgccatgcttttgaaaaagaatgg atagaatgtgcacatggaatcggttatactcgggcagagaaagagtgcaagatagaatat gatgatttcgtagagtgtttgcttcggcagaaaacgatgagacgtgcaggtaccatcagg aagcagcgggataagctgataaaggaaggaaagtacacccctccacctcaccacattggc aagggggagcctcggccctga

Homo sapiens (human): 4726 Help Entry 4726              CDS       T01001                                  Symbol NDUFS6, CI-13kA, CI-13kD-A, CI13KDA, MC1DN9 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit S6   KO K03939   NADH dehydrogenase (ubiquinone) Fe-S protein 6 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4726 (NDUFS6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4726 (NDUFS6)   09159 Environmental adaptation    04714 Thermogenesis     4726 (NDUFS6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4726 (NDUFS6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4726 (NDUFS6)    05012 Parkinson disease     4726 (NDUFS6)    05014 Amyotrophic lateral sclerosis     4726 (NDUFS6)    05016 Huntington disease     4726 (NDUFS6)    05020 Prion disease     4726 (NDUFS6)    05022 Pathways of neurodegeneration - multiple diseases     4726 (NDUFS6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4726 (NDUFS6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4726 (NDUFS6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-CHCC Thiolase_C Motif Other DBs NCBI-GeneID:  4726 NCBI-ProteinID:  NP_004544 OMIM:  603848 HGNC:  7713 Ensembl:  ENSG00000145494 UniProt:  O75380 Q6IBC4 Structure PDB LinkDB All DBs Position 5:1801407..1816048 Genome browser AA seq 124 aa AA seqDB search MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR QHHH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatgaccttctgccggctgctgaaccggtgtggcgaggcggcgcggagc ctgcccctgggcgccaggtgtttcggggtgcgggtctcgccgaccggggagaaggtcacg cacactggccaggtttatgatgataaagactacaggagaattcggtttgtaggtcgtcag aaagaggtgaatgaaaactttgccattgatttgatagcagagcagcccgtgagcgaggtg gagactcgggtgatagcgtgcgatggcggcgggggagctcttggccacccaaaagtgtat ataaacttggacaaagaaacaaaaaccggcacatgcggttactgtgggctccagttcaga cagcaccaccactag

Homo sapiens (human): 374291 Help Entry 374291            CDS       T01001                                  Symbol NDUFS7, CI-20, CI-20KD, MC1DN3, MY017, PSST Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S7   KO K03940   NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     374291 (NDUFS7)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     374291 (NDUFS7)   09159 Environmental adaptation    04714 Thermogenesis     374291 (NDUFS7)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     374291 (NDUFS7)   09164 Neurodegenerative disease    05010 Alzheimer disease     374291 (NDUFS7)    05012 Parkinson disease     374291 (NDUFS7)    05014 Amyotrophic lateral sclerosis     374291 (NDUFS7)    05016 Huntington disease     374291 (NDUFS7)    05020 Prion disease     374291 (NDUFS7)    05022 Pathways of neurodegeneration - multiple diseases     374291 (NDUFS7)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     374291 (NDUFS7)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     374291 (NDUFS7) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      374291 (NDUFS7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q6 Secapin Motif Other DBs NCBI-GeneID:  374291 NCBI-ProteinID:  NP_077718 OMIM:  601825 HGNC:  7714 Ensembl:  ENSG00000115286 UniProt:  O75251 Q7LD69 Structure PDB LinkDB All DBs Position 19:1383907..1395584 Genome browser AA seq 213 aa AA seqDB search MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcggtgctgtcagctcctggcctgcgcggcttccggatccttggtctgcgctccagc gtgggcccggctgtgcaggcacgaggtgtccatcagagcgtggccaccgatggcccaagc agcacccagcctgccctgccaaaggccagagccgtggctcccaaacccagcagccggggc gagtatgtggtggccaagctggatgacctcgtcaactgggcccgccggagttctctgtgg cccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcagcaccccgc tacgacatggaccgctttggcgtggtcttccgcgccagcccgcgccagtccgacgtcatg atcgtggccggcacactcaccaacaagatggccccagcgcttcgcaaggtctacgaccag atgccggagccgcgctacgtggtctccatggggagctgcgccaacggaggaggctactac cactattcctactcggtggtgaggggctgcgaccgcatcgtgcccgtggacatctacatc ccaggctgcccacctacggccgaggccctgctctacggcatcctgcagctgcagaggaag atcaagcgggagcggaggctgcagatctggtaccgcaggtag

Homo sapiens (human): 4728 Help Entry 4728              CDS       T01001                                  Symbol NDUFS8, CI-23k, CI23KD, MC1DN2, TYKY Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S8   KO K03941   NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4728 (NDUFS8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4728 (NDUFS8)   09159 Environmental adaptation    04714 Thermogenesis     4728 (NDUFS8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4728 (NDUFS8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4728 (NDUFS8)    05012 Parkinson disease     4728 (NDUFS8)    05014 Amyotrophic lateral sclerosis     4728 (NDUFS8)    05016 Huntington disease     4728 (NDUFS8)    05020 Prion disease     4728 (NDUFS8)    05022 Pathways of neurodegeneration - multiple diseases     4728 (NDUFS8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4728 (NDUFS8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4728 (NDUFS8) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4728 (NDUFS8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_6 Fer4_9 Fer4_10 Fer4_8 Fer4_2 Fer4_4 Fer4_17 Fer4_3 Motif Other DBs NCBI-GeneID:  4728 NCBI-ProteinID:  NP_002487 OMIM:  602141 HGNC:  7715 Ensembl:  ENSG00000110717 UniProt:  O00217 Structure PDB LinkDB All DBs Position 11:68030681..68036644 Genome browser AA seq 210 aa AA seqDB search MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLL WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE LLYNKEKLLNNGDKWEAEIAANIQADYLYR NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgcgctgcctgaccacgcctatgctgctgcgggccctggcccaggctgcacgtgcagga cctcctggtggccggagcctccacagcagtgcagtggcagccacctacaagtatgtgaac atgcaggatcccgagatggacatgaagtcagtgactgaccgggcagcccgcaccctgctg tggactgagctcttccgaggcctgggcatgaccctgagctacctgttccgggaaccggcc accatcaactacccgttcgagaagggcccgctgagccctcgcttccgtggggagcatgcg ctgcgccggtacccatccggggaggagcgttgcattgcctgcaagctctgcgaggccatc tgccccgcccaggccatcaccatcgaggctgagccaagagctgatggcagccgccggacc acccgctatgacatcgacatgaccaagtgcatctactgcggcttctgccaggaggcctgt cccgtggatgccatcgtcgagggccccaactttgagttctccacggagacccatgaggag ctgctgtacaacaaggagaagttgctcaacaacggggacaagtgggaggccgagatcgcc gccaacatccaggctgactacttgtatcggtga

Homo sapiens (human): 4723 Help Entry 4723              CDS       T01001                                  Symbol NDUFV1, CI-51K, CI51KD, MC1DN4, UQOR1 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit V1   KO K03942   NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4723 (NDUFV1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4723 (NDUFV1)   09159 Environmental adaptation    04714 Thermogenesis     4723 (NDUFV1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4723 (NDUFV1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4723 (NDUFV1)    05012 Parkinson disease     4723 (NDUFV1)    05014 Amyotrophic lateral sclerosis     4723 (NDUFV1)    05016 Huntington disease     4723 (NDUFV1)    05020 Prion disease     4723 (NDUFV1)    05022 Pathways of neurodegeneration - multiple diseases     4723 (NDUFV1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4723 (NDUFV1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4723 (NDUFV1) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4723 (NDUFV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_51K NADH_4Fe-4S SLBB Motif Other DBs NCBI-GeneID:  4723 NCBI-ProteinID:  NP_009034 OMIM:  161015 HGNC:  7716 Ensembl:  ENSG00000167792 UniProt:  P49821 E5KNH5 Structure PDB LinkDB All DBs Position 11:67606936..67612554 Genome browser AA seq 464 aa AA seqDB search MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgctggcaacacggcggctgctcggctggtcgcttcccgcgcgggtatctgtgcgtttc agcggcgacacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg attttcaccaacctgtacggccgccatgactggaggctgaaaggttccctgagtcgaggt gactggtacaagacaaaggagatcctgctgaaggggcccgactggatcctgggcgagatc aagacatcgggtttgaggggccgtggaggcgctggcttccccactggcctcaagtggagc ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaacgcagacgagggg gagccgggcacctgcaaggaccgggagatcttacgccatgatcctcacaagctgctggaa ggctgcctggtggggggccgggccatgggcgcccgcgctgcctatatctacatccgaggg gaattctacaatgaggcctccaatctgcaggtggccatccgagaggcctatgaggcaggt ctgattggcaagaatgcttgtggctctggctatgattttgacgtgtttgtggtgcgcggg gctggggcctacatctgtggagaggagacagcgctcatcgagtccattgagggcaagcag ggcaagccccgcctgaagccccccttccccgcagacgtgggagtgtttggctgccccaca actgtggccaacgtggagacagtggcagtgtcccccacaatctgccgccgtggaggtacc tggtttgctggctttggcagagaacgcaactcaggcaccaaactattcaacatctctggc catgtcaaccacccttgcactgtggaggaggagatgtctgtgcccttgaaagaactgatt gagaagcatgctgggggtgtcacgggcggctgggacaacctccttgctgtgatccctggc ggctcgtctaccccactgatccccaagtctgtgtgtgagacggtgctgatggacttcgat gcgctggtgcaggcacagacaggcctgggcacagctgcggtgatcgtcatggaccgctcg acggacatcgtgaaagccatcgcccgcctcattgagttctataagcacgagagctgtggc cagtgtaccccatgccgtgagggtgtggactggatgaacaaggtgatggcacgtttcgtg aggggggatgcccggccggccgagatcgactccctgtgggagatcagcaagcagatagaa ggccatacgatttgtgctctgggtgacggggccgcctggcctgtgcagggtctgatccgc cactttcggccggagctcgaggagcggatgcagcggtttgcccagcagcatcaggcccgg caggctgcctcttag

Homo sapiens (human): 4729 Help Entry 4729              CDS       T01001                                  Symbol NDUFV2, CI-24k, MC1DN7 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit V2   KO K03943   NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4729 (NDUFV2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4729 (NDUFV2)   09159 Environmental adaptation    04714 Thermogenesis     4729 (NDUFV2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4729 (NDUFV2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4729 (NDUFV2)    05012 Parkinson disease     4729 (NDUFV2)    05014 Amyotrophic lateral sclerosis     4729 (NDUFV2)    05016 Huntington disease     4729 (NDUFV2)    05020 Prion disease     4729 (NDUFV2)    05022 Pathways of neurodegeneration - multiple diseases     4729 (NDUFV2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4729 (NDUFV2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4729 (NDUFV2) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4729 (NDUFV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  2Fe-2S_thioredx Motif Other DBs NCBI-GeneID:  4729 NCBI-ProteinID:  NP_066552 OMIM:  600532 HGNC:  7717 Ensembl:  ENSG00000178127 UniProt:  P19404 Structure PDB LinkDB All DBs Position 18:9102699..9134341 Genome browser AA seq 249 aa AA seqDB search MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atgttcttctccgcggcgctccgggcccgggcggctggcctcaccgcccactggggaaga catgtaaggaatttgcataagacagttatgcaaaatggagctggaggagctttatttgtg cacagagatactcctgagaataaccctgatactccatttgatttcacaccagaaaactat aagaggatagaggcaattgtaaaaaactatccagaaggccataaagcagcagctgttctt ccagtcctggatttagcccaaaggcagaatgggtggttgcccatctctgctatgaacaag gttgcagaagttttacaagtacctccaatgagagtatatgaagtagcaactttttataca atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccctgc atgcttcgaaactctgacagcatactggaggccattcagaaaaagcttggaataaaggtt ggggagactacacctgacaaacttttcactcttatagaagtggaatgtttaggggcctgt gtgaacgcaccaatggttcaaataaatgacaattactatgaggatttgacagctaaggat attgaagaaattattgatgagctcaaggctggcaaaatcccaaaaccagggccaaggagt ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaggga cctggatttggtgtacaagcaggcctttaa

Homo sapiens (human): 4731 Help Entry 4731              CDS       T01001                                  Symbol NDUFV3, CI-10k, CI-9KD Name (RefSeq) NADH:ubiquinone oxidoreductase subunit V3   KO K03944   NADH dehydrogenase (ubiquinone) flavoprotein 3 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4731 (NDUFV3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4731 (NDUFV3)   09159 Environmental adaptation    04714 Thermogenesis     4731 (NDUFV3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4731 (NDUFV3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4731 (NDUFV3)    05012 Parkinson disease     4731 (NDUFV3)    05014 Amyotrophic lateral sclerosis     4731 (NDUFV3)    05016 Huntington disease     4731 (NDUFV3)    05020 Prion disease     4731 (NDUFV3)    05022 Pathways of neurodegeneration - multiple diseases     4731 (NDUFV3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4731 (NDUFV3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4731 (NDUFV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFV3 Med26_C Motif Other DBs NCBI-GeneID:  4731 NCBI-ProteinID:  NP_001001503 OMIM:  602184 HGNC:  7719 Ensembl:  ENSG00000160194 UniProt:  P56181 Structure PDB LinkDB All DBs Position 21:42893309..42913299 Genome browser AA seq 108 aa AA seqDB search MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAP VPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccccgtgtttgctgcggcaaggacgagccggggcgctgaagactatgctccag gaagcccaggtgtttcgaggacttgcttctacggtttctttgtctgcggaatcagggaag agtgaaaagggtcagccacagaattccaagaagcaaagtccaccaaaaaagccagcccca gtgcctgctgagccgtttgacaacactacctacaagaacctgcagcatcatgactacagc acgtacaccttcttagacctcaacctcgaactctcaaaattcaggatgcctcagccctcc tcaggccgggagtcacctcgacactga

Homo sapiens (human): 4694 Help Entry 4694              CDS       T01001                                  Symbol NDUFA1, CI-MWFE, MC1DN12, MWFE, ZNF183 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A1   KO K03945   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4694 (NDUFA1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4694 (NDUFA1)   09159 Environmental adaptation    04714 Thermogenesis     4694 (NDUFA1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4694 (NDUFA1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4694 (NDUFA1)    05012 Parkinson disease     4694 (NDUFA1)    05014 Amyotrophic lateral sclerosis     4694 (NDUFA1)    05016 Huntington disease     4694 (NDUFA1)    05020 Prion disease     4694 (NDUFA1)    05022 Pathways of neurodegeneration - multiple diseases     4694 (NDUFA1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4694 (NDUFA1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4694 (NDUFA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MWFE Motif Other DBs NCBI-GeneID:  4694 NCBI-ProteinID:  NP_004532 OMIM:  300078 HGNC:  7683 Ensembl:  ENSG00000125356 UniProt:  O15239 Q6IBB5 Structure PDB LinkDB All DBs Position X:119871832..119876662 Genome browser AA seq 70 aa AA seqDB search MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY YVSKGLENID NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtggttcgagattctccccggactctccgtcatgggcgtgtgcttgttgattccagga ctggctactgcgtacatccacaggttcactaacgggggcaaggaaaaaagggttgctcat tttgggtatcactggagtctgatggaaagagataggcgcatctctggagttgatcgttac tatgtgtcaaagggtttggagaacattgattaa

Homo sapiens (human): 4695 Help Entry 4695              CDS       T01001                                  Symbol NDUFA2, B8, CD14, CIB8, MC1DN13 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A2   KO K03946   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4695 (NDUFA2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4695 (NDUFA2)   09159 Environmental adaptation    04714 Thermogenesis     4695 (NDUFA2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4695 (NDUFA2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4695 (NDUFA2)    05012 Parkinson disease     4695 (NDUFA2)    05014 Amyotrophic lateral sclerosis     4695 (NDUFA2)    05016 Huntington disease     4695 (NDUFA2)    05020 Prion disease     4695 (NDUFA2)    05022 Pathways of neurodegeneration - multiple diseases     4695 (NDUFA2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4695 (NDUFA2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4695 (NDUFA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  L51_S25_CI-B8 Motif Other DBs NCBI-GeneID:  4695 NCBI-ProteinID:  NP_002479 OMIM:  602137 HGNC:  7685 Ensembl:  ENSG00000131495 UniProt:  O43678 Structure PDB LinkDB All DBs Position 5:complement(140645285..140647630) Genome browser AA seq 99 aa AA seqDB search MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat gtgcagcccaagctctgggcccgctacgcatttggccaagagacgaatgtccctttgaac aacttcagtgctgatcaggtaaccagagccctggagaacgttctaagtggtaaagcctga

Homo sapiens (human): 4696 Help Entry 4696              CDS       T01001                                  Symbol NDUFA3, B9, CI-B9 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A3   KO K03947   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4696 (NDUFA3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4696 (NDUFA3)   09159 Environmental adaptation    04714 Thermogenesis     4696 (NDUFA3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4696 (NDUFA3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4696 (NDUFA3)    05012 Parkinson disease     4696 (NDUFA3)    05014 Amyotrophic lateral sclerosis     4696 (NDUFA3)    05016 Huntington disease     4696 (NDUFA3)    05020 Prion disease     4696 (NDUFA3)    05022 Pathways of neurodegeneration - multiple diseases     4696 (NDUFA3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4696 (NDUFA3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4696 (NDUFA3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NADHdh_A3 Motif Other DBs NCBI-GeneID:  4696 NCBI-ProteinID:  NP_004533 OMIM:  603832 HGNC:  7686 Ensembl:  ENSG00000170906 UniProt:  O95167 Q6FGG4 Structure PDB LinkDB All DBs Position 19:54102855..54107568 Genome browser AA seq 84 aa AA seqDB search MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDD GNMPDVPSHPQDPQGPSLEWLKKL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgcgagagtcggcgccttcctcaagaatgcctgggacaaggagccagtgctggtc gtgtccttcgtcgtcgggggcctcgctgtaattctgcccccattgagcccctacttcaag tactccgtcatgatcaacaaggccacgccctacaactacccagtgcccgtccgtgatgat gggaacatgcccgacgtgcccagccacccccaggaccctcagggccccagcctggagtgg ctgaagaaactgtga

Homo sapiens (human): 4697 Help Entry 4697              CDS       T01001                                  Symbol NDUFA4, CI-9k, CI-MLRQ, COXFA4, MC4DN21, MISTR1, MLRQ, MRCAF1 Name (RefSeq) NDUFA4 mitochondrial complex associated   KO K03948   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H01368   Cytochrome c oxidase (COX) deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4697 (NDUFA4)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4697 (NDUFA4)   09159 Environmental adaptation    04714 Thermogenesis     4697 (NDUFA4)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4697 (NDUFA4)   09164 Neurodegenerative disease    05010 Alzheimer disease     4697 (NDUFA4)    05012 Parkinson disease     4697 (NDUFA4)    05014 Amyotrophic lateral sclerosis     4697 (NDUFA4)    05016 Huntington disease     4697 (NDUFA4)    05020 Prion disease     4697 (NDUFA4)    05022 Pathways of neurodegeneration - multiple diseases     4697 (NDUFA4)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4697 (NDUFA4)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4697 (NDUFA4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  B12D Motif Other DBs NCBI-GeneID:  4697 NCBI-ProteinID:  NP_002480 OMIM:  603833 HGNC:  7687 Ensembl:  ENSG00000189043 UniProt:  O00483 Structure PDB LinkDB All DBs Position 7:complement(10931943..10940153) Genome browser AA seq 81 aa AA seqDB search MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPND QYKFYSVNVDYSKLKKERPDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgctccgccagatcatcggtcaggccaagaagcatccgagcttgatccccctctttgta tttattggaactggagctactggagcaacactgtatctcttgcgtctggcattgttcaat ccagatgtttgttgggacagaaataacccagagccctggaacaaactgggtcccaatgat caatacaagttctactcagtgaatgtggattacagcaagctgaagaaggaacgtccagat ttctaa

Homo sapiens (human): 4698 Help Entry 4698              CDS       T01001                                  Symbol NDUFA5, B13, CI-13KD-B, CI-13kB, NUFM, UQOR13 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A5   KO K03949   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4698 (NDUFA5)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4698 (NDUFA5)   09159 Environmental adaptation    04714 Thermogenesis     4698 (NDUFA5)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4698 (NDUFA5)   09164 Neurodegenerative disease    05010 Alzheimer disease     4698 (NDUFA5)    05012 Parkinson disease     4698 (NDUFA5)    05014 Amyotrophic lateral sclerosis     4698 (NDUFA5)    05016 Huntington disease     4698 (NDUFA5)    05020 Prion disease     4698 (NDUFA5)    05022 Pathways of neurodegeneration - multiple diseases     4698 (NDUFA5)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4698 (NDUFA5)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4698 (NDUFA5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ETC_C1_NDUFA5 Methyltransf_16 Motif Other DBs NCBI-GeneID:  4698 NCBI-ProteinID:  NP_001269349 OMIM:  601677 HGNC:  7688 Ensembl:  ENSG00000128609 UniProt:  Q16718 Structure PDB LinkDB All DBs Position 7:complement(123536997..123601651) Genome browser AA seq 116 aa AA seqDB search MPYRVGQTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVK AEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgccttaccgggtagggcagaccactggccttgtgggattggctgtgtgcaatactcct cacgagaggctaagaatattgtacacaaagattcttgatgttcttgaggaaatccctaaa aatgcagcatatagaaagtatacagaacagattacaaatgagaagctggctatggttaaa gcggaaccagatgttaaaaaattagaagaccaacttcaaggcggtcaattagaagaggtg attcttcaggctgaacatgaactaaatctggcaagaaaaatgagggaatggaaactatgg gagccattagtggaagagcctcctgccgatcagtggaaatggccaatataa

Homo sapiens (human): 4700 Help Entry 4700              CDS       T01001                                  Symbol NDUFA6, B14, CI-B14, LYRM6, MC1DN33, NADHB14 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A6   KO K03950   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4700 (NDUFA6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4700 (NDUFA6)   09159 Environmental adaptation    04714 Thermogenesis     4700 (NDUFA6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4700 (NDUFA6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4700 (NDUFA6)    05012 Parkinson disease     4700 (NDUFA6)    05014 Amyotrophic lateral sclerosis     4700 (NDUFA6)    05016 Huntington disease     4700 (NDUFA6)    05020 Prion disease     4700 (NDUFA6)    05022 Pathways of neurodegeneration - multiple diseases     4700 (NDUFA6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4700 (NDUFA6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4700 (NDUFA6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_LYR Complex1_LYR_2 GH115_C Motif Other DBs NCBI-GeneID:  4700 NCBI-ProteinID:  NP_002481 OMIM:  602138 HGNC:  7690 Ensembl:  ENSG00000184983 UniProt:  P56556 A0A2Y9D025 Structure PDB LinkDB All DBs Position 22:complement(42085526..42090772) Genome browser AA seq 128 aa AA seqDB search MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS KFYVGHDP NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcggggagcggcgtccgccaagctacttctaccgccagcaccttcgtgaagcccatt ttcagtcgggacatgaacgaggccaagcggagggtgcgcgagctctaccgcgcctggtat cgggaggtgccgaacactgtgcaccaattccagctggacatcactgtgaaaatgggacgg gataaagtccgagaaatgtttatgaagaatgcccatgtcacagaccccagggtggttgat cttctggtcattaagggaaagatcgaactggaagaaacaattaaagtatggaagcagcgg acacatgttatgcggttcttccatgaaacagaagcgccaaggccaaaggatttcctatcc aagttctatgttggccacgatccatga

Homo sapiens (human): 4701 Help Entry 4701              CDS       T01001                                  Symbol NDUFA7, B14.5a, CI-B14.5a Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A7   KO K03951   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4701 (NDUFA7)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4701 (NDUFA7)   09159 Environmental adaptation    04714 Thermogenesis     4701 (NDUFA7)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4701 (NDUFA7)   09164 Neurodegenerative disease    05010 Alzheimer disease     4701 (NDUFA7)    05012 Parkinson disease     4701 (NDUFA7)    05014 Amyotrophic lateral sclerosis     4701 (NDUFA7)    05016 Huntington disease     4701 (NDUFA7)    05020 Prion disease     4701 (NDUFA7)    05022 Pathways of neurodegeneration - multiple diseases     4701 (NDUFA7)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4701 (NDUFA7)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4701 (NDUFA7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CI-B14_5a Motif Other DBs NCBI-GeneID:  4701 NCBI-ProteinID:  NP_004992 OMIM:  602139 HGNC:  7691 Ensembl:  ENSG00000267855 UniProt:  O95182 Structure PDB LinkDB All DBs Position 19:complement(8308595..8321375) Genome browser AA seq 113 aa AA seqDB search MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGR RESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgtccgccacccgtctcatccagcggctgcggaactgggcgtccgggcatgacctg caggggaagctgcagctacgctaccaggagatctccaagcgaactcagcctcctcccaag ctccctgtgggtcctagccacaagctctccaacaattactattgcactcgcgatggccgc cgggaatctgtgcccccttccatcatcatgtcgtcgcagaaggcgctggtgtcaggcaag ccagcagagagctctgctgtagctgccactgagaagaaggcggtgactccagctcctccc ataaagaggtgggagctgtcctcggaccagccttacctgtga

Homo sapiens (human): 4702 Help Entry 4702              CDS       T01001                                  Symbol NDUFA8, CI-19KD, CI-PGIV, MC1DN37, PGIV Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A8   KO K03952   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4702 (NDUFA8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4702 (NDUFA8)   09159 Environmental adaptation    04714 Thermogenesis     4702 (NDUFA8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4702 (NDUFA8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4702 (NDUFA8)    05012 Parkinson disease     4702 (NDUFA8)    05014 Amyotrophic lateral sclerosis     4702 (NDUFA8)    05016 Huntington disease     4702 (NDUFA8)    05020 Prion disease     4702 (NDUFA8)    05022 Pathways of neurodegeneration - multiple diseases     4702 (NDUFA8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4702 (NDUFA8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4702 (NDUFA8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CHCH CX9C COX6B Cmc1 Motif Other DBs NCBI-GeneID:  4702 NCBI-ProteinID:  NP_055037 OMIM:  603359 HGNC:  7692 Ensembl:  ENSG00000119421 UniProt:  P51970 Structure PDB LinkDB All DBs Position 9:complement(122132466..122159779) Genome browser AA seq 172 aa AA seqDB search MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEG KLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRP DLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgccggggatagtggagctgcccactctagaggagctgaaagtagatgaggtgaaaatt agttctgctgtgcttaaagctgcggcccatcactatggagctcaatgtgataagcccaac aaggagtttatgctctgccgctgggaagagaaagatccgaggcggtgtttagaggaaggc aaactggtcaacaagtgtgctttggacttctttaggcagataaaacgtcactgtgcagag ccttttacagaatattggacttgcattgattatactggccagcagttatttcgtcactgt cgcaaacagcaggcaaagtttgacgagtgtgtgctggacaaactgggctgggtgcggcct gacctgggagaactgtcaaaggtcaccaaagtgaaaacagatcgacctttaccggagaat ccctatcactcaagaccaagaccggatcccagccctgagatcgagggagatctgcagcct gccacacatggcagccgcttttatttctggaccaagtaa

Homo sapiens (human): 4704 Help Entry 4704              CDS       T01001                                  Symbol NDUFA9, CC6, CI-39k, CI39k, COQ11, MC1DN26, NDUFS2L, SDR22E1 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A9   KO K03953   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4704 (NDUFA9)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4704 (NDUFA9)   09159 Environmental adaptation    04714 Thermogenesis     4704 (NDUFA9)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4704 (NDUFA9)   09164 Neurodegenerative disease    05010 Alzheimer disease     4704 (NDUFA9)    05012 Parkinson disease     4704 (NDUFA9)    05014 Amyotrophic lateral sclerosis     4704 (NDUFA9)    05016 Huntington disease     4704 (NDUFA9)    05020 Prion disease     4704 (NDUFA9)    05022 Pathways of neurodegeneration - multiple diseases     4704 (NDUFA9)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4704 (NDUFA9)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4704 (NDUFA9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Epimerase 3Beta_HSD NmrA NAD_binding_10 RmlD_sub_bind GDP_Man_Dehyd NAD_binding_4 adh_short Motif Other DBs NCBI-GeneID:  4704 NCBI-ProteinID:  NP_004993 OMIM:  603834 HGNC:  7693 Ensembl:  ENSG00000139180 UniProt:  Q16795 Structure PDB LinkDB All DBs Position 12:4649114..4694317 Genome browser AA seq 377 aa AA seqDB search MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR WLSAEIEDVKPAKTVNI NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt atggcggctgccgcacaatcccgggttgtccgggtcctgtcaatgtcacgttctgccatt actgcaatagccacatctgtgtgtcacggcccaccctgtcgccagcttcatcatgccctc atgcctcatgggaaaggtggacgttcctcagtcagtgggattgtggccactgtgtttgga gcaacaggattcctggggcgatatgttgtcaaccaccttggacgcatggggtcacaggta atcataccctatcggtgtgataaatatgacatcatgcaccttcgtcccatgggtgacctg ggccagcttctgtttctggaatgggacgcgagagataaagattctatccgacgagtagta caacacagcaatgtggtcatcaatcttattggacgagactgggaaaccaaaaactttgat tttgaggatgtttttgtgaagattccccaagcaattgctcaactgtccaaggaagctgga gttgaaaaattcattcatgtttcacatctgaatgcgaatattaaaagctcttctagatat ttgagaaataaggctgttggagagaaagtagtgagagatgcatttccggaagccattatc gtaaagccgtcggacatctttggaagagaggatagattccttaattcttttgcaagtatg catcggtttggtcctataccccttggttccttgggctggaagacagttaaacaaccagta tatgtcgtagatgtatccaaaggaattgttaatgcagttaaggatcctgatgccaatggg aaatcctttgctttcgttggtcccagtcggtacctccttttccacctggtgaagtacatc tttgctgtggctcacagattgttcctcccattccccttgccgctttttgcctatcgatgg gtagcaagagtctttgaaataagcccatttgagccctggataacaagggataaagtggag cggatgcacatcacagacatgaaattgcctcacctgcctggcttagaagaccttggtatt caggcaacaccactggaactcaaggccattgaggtgctgcggcgtcatcgcacttaccgc tggctgtctgctgaaattgaggatgtgaagccggccaagaccgtcaacatttag

Homo sapiens (human): 4705 Help Entry 4705              CDS       T01001                                  Symbol NDUFA10, CI-42KD, CI-42k, MC1DN22 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A10   KO K03954   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4705 (NDUFA10)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4705 (NDUFA10)   09159 Environmental adaptation    04714 Thermogenesis     4705 (NDUFA10)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4705 (NDUFA10)   09164 Neurodegenerative disease    05010 Alzheimer disease     4705 (NDUFA10)    05012 Parkinson disease     4705 (NDUFA10)    05014 Amyotrophic lateral sclerosis     4705 (NDUFA10)    05016 Huntington disease     4705 (NDUFA10)    05020 Prion disease     4705 (NDUFA10)    05022 Pathways of neurodegeneration - multiple diseases     4705 (NDUFA10)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4705 (NDUFA10)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4705 (NDUFA10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dNK AAA_28 AAA_17 Thymidylate_kin Cytidylate_kin TsaE Cytidylate_kin2 AAA_18 Motif Other DBs NCBI-GeneID:  4705 NCBI-ProteinID:  NP_004535 OMIM:  603835 HGNC:  7684 Ensembl:  ENSG00000130414 UniProt:  O95299 Structure PDB LinkDB All DBs Position 2:complement(239892442..240025342) Genome browser AA seq 355 aa AA seqDB search MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVI TVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDD PRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIR KQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENA YKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQD KFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt atggccttgcggctcctgaagctggcagcgacgtccgcgtccgcccgggtcgtggcggcg ggcgcccagcgcgtgagaggaattcatagcagtgtgcagtgcaaactgcgctatggaatg tggcatttcctacttggggataaagcaagcaaaagactgacagaacgcagcagagtgata actgtagatggcaatatatgtactggaaaaggcaaacttgcaaaagaaatagcagagaaa ctaggcttcaagcactttcctgaagcggggattcattatccagacagtaccacaggagat gggaagcccctcgccaccgactataatggcaactgtagtttggagaaattttacgatgat ccgagaagcaatgatggcaacagttaccgcctgcagtcctggttgtacagcagtcgcctg ctgcagtactcagatgccttggagcacttgctgaccacaggacaaggtgttgtgttggag cgctccatcttcagtgactttgtgttcctggaggcgatgtacaaccagggattcatccga aagcagtgtgtggaccactacaacgaggtgaagagcgtcaccatctgcgattacctgccc ccccacctggtgatttacatcgatgtgcccgttccagaggtccagaggcggattcagaag aaaggagatccacatgaaatgaagatcacctctgcctatctacaggacattgagaatgcc tataagaaaacctttctccctgagatgagtgaaaaatgtgaggttttacaatattctgca agggaagctcaagattcaaaaaaggtggtagaggacattgaatacctgaagttcgataaa gggccgtggctcaagcaggacaatcgcactttataccacctgcgattactggttcaggat aagtttgaggtgctgaattacacaagcattcctatctttctcccggaagtcaccattgga gctcatcagactgaccgtgtcttacatcagttcagagagctgccgggccgcaagtacagc cctgggtacaacaccgaggtgggagacaagtggatctggctgaagtga

Homo sapiens (human): 4706 Help Entry 4706              CDS       T01001                                  Symbol NDUFAB1, ACP, ACP1, FASN2A, SDAP Name (RefSeq) NADH:ubiquinone oxidoreductase subunit AB1   KO K03955   NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex hsa_M00873   Fatty acid biosynthesis in mitochondria, animals Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4706 (NDUFAB1)   09103 Lipid metabolism    00061 Fatty acid biosynthesis     4706 (NDUFAB1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4706 (NDUFAB1)   09159 Environmental adaptation    04714 Thermogenesis     4706 (NDUFAB1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4706 (NDUFAB1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4706 (NDUFAB1)    05012 Parkinson disease     4706 (NDUFAB1)    05014 Amyotrophic lateral sclerosis     4706 (NDUFAB1)    05016 Huntington disease     4706 (NDUFAB1)    05020 Prion disease     4706 (NDUFAB1)    05022 Pathways of neurodegeneration - multiple diseases     4706 (NDUFAB1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4706 (NDUFAB1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4706 (NDUFAB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 MinE Motif Other DBs NCBI-GeneID:  4706 NCBI-ProteinID:  NP_004994 OMIM:  603836 HGNC:  7694 Ensembl:  ENSG00000004779 UniProt:  O14561 Structure PDB LinkDB All DBs Position 16:complement(23581014..23596316) Genome browser AA seq 156 aa AA seqDB search MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGR VTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcgtctcgtgtcctttcagcctatgtcagccgcctgcccgcggcctttgcgccgctg ccccgggtccggatgctggccgtggcccggcctctcagcaccgctctctgctccgcgggg acccagacgaggctcgggactttgcagccggccttagtgctcgcgcaggttcctggtaga gttacacagttgtgccgccagtatagcgacatgcctcctttgacgttagagggcatccag gaccgtgttctttacgtattgaaactctatgacaagattgacccagagaagctttcagta aattctcattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg gccatggaagacgaatttgggtttgaaattcctgatatagatgctgaaaagttaatgtgt ccacaagaaattgtagattacattgcagataagaaggatgtatatgaataa

Homo sapiens (human): 126328 Help Entry 126328            CDS       T01001                                  Symbol NDUFA11, B14.7, CI-B14.7, MC1DN14 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A11   KO K03956   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     126328 (NDUFA11)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     126328 (NDUFA11)   09159 Environmental adaptation    04714 Thermogenesis     126328 (NDUFA11)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     126328 (NDUFA11)   09164 Neurodegenerative disease    05010 Alzheimer disease     126328 (NDUFA11)    05012 Parkinson disease     126328 (NDUFA11)    05014 Amyotrophic lateral sclerosis     126328 (NDUFA11)    05016 Huntington disease     126328 (NDUFA11)    05020 Prion disease     126328 (NDUFA11)    05022 Pathways of neurodegeneration - multiple diseases     126328 (NDUFA11)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     126328 (NDUFA11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     126328 (NDUFA11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tim17 Motif Other DBs NCBI-GeneID:  126328 NCBI-ProteinID:  NP_783313 OMIM:  612638 HGNC:  20371 Ensembl:  ENSG00000174886 UniProt:  Q86Y39 Structure PDB LinkDB All DBs Position 19:complement(5891229..5903790) Genome browser AA seq 141 aa AA seqDB search MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT FTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGI AASLVKMGRLEGWEVFAKPKV NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcgccgaaggtttttcgtcagtactgggatatccccgatggcaccgattgccaccgc aaagcctacagcaccaccagtattgccagcgtcgctggcctgaccgccgctgcctacaga gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg ttcactgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtc cgcgagaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgact ctgggagcacgcacgcacaactacgggattggcgccgccgcctgcgtgtactttggcata gcggcctccctggtcaagatgggccggctggagggctgggaggtgtttgcaaaacccaag gtgtga

Homo sapiens (human): 55967 Help Entry 55967             CDS       T01001                                  Symbol NDUFA12, B17.2, DAP13, MC1DN23 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A12   KO K11352   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     55967 (NDUFA12)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     55967 (NDUFA12)   09159 Environmental adaptation    04714 Thermogenesis     55967 (NDUFA12)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     55967 (NDUFA12)   09164 Neurodegenerative disease    05010 Alzheimer disease     55967 (NDUFA12)    05012 Parkinson disease     55967 (NDUFA12)    05014 Amyotrophic lateral sclerosis     55967 (NDUFA12)    05016 Huntington disease     55967 (NDUFA12)    05020 Prion disease     55967 (NDUFA12)    05022 Pathways of neurodegeneration - multiple diseases     55967 (NDUFA12)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     55967 (NDUFA12)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     55967 (NDUFA12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFA12 Motif Other DBs NCBI-GeneID:  55967 NCBI-ProteinID:  NP_061326 OMIM:  614530 HGNC:  23987 Ensembl:  ENSG00000184752 UniProt:  Q9UI09 Structure PDB LinkDB All DBs Position 12:complement(94971333..95003697) Genome browser AA seq 145 aa AA seqDB search MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHR WVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGT PEQYVPYSTTRKKIQEWIPPSTPYK NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggagttagtgcaggtcctgaaacgcgggctgcagcagatcaccggccacggcggtctc cgaggctatctacgggtttttttcaggacaaatgatgcgaaggttggtacattagtgggg gaagacaaatatggaaacaaatactatgaagacaacaagcaattttttggccgtcaccga tgggttgtatatactactgaaatgaatggcaaaaacacattctgggatgtggatggaagc atggtgcctcctgaatggcatcgttggcttcacagtatgactgatgatcctccaacaaca aaaccacttactgctcgtaaattcatttggacgaaccataaattcaacgtgactggcacc ccagaacaatatgtaccttattctaccactagaaagaagattcaggagtggatcccacct tcaacaccttacaagtaa

Homo sapiens (human): 51079 Help Entry 51079             CDS       T01001                                  Symbol NDUFA13, B16.6, CDA016, CGI-39, GRIM-19, GRIM19, MC1DN28 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A13   KO K11353   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     51079 (NDUFA13)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     51079 (NDUFA13)   09159 Environmental adaptation    04714 Thermogenesis     51079 (NDUFA13)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     51079 (NDUFA13)   09164 Neurodegenerative disease    05010 Alzheimer disease     51079 (NDUFA13)    05012 Parkinson disease     51079 (NDUFA13)    05014 Amyotrophic lateral sclerosis     51079 (NDUFA13)    05016 Huntington disease     51079 (NDUFA13)    05020 Prion disease     51079 (NDUFA13)    05022 Pathways of neurodegeneration - multiple diseases     51079 (NDUFA13)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     51079 (NDUFA13)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     51079 (NDUFA13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GRIM-19 COX14 CSTF_C Motif Other DBs NCBI-GeneID:  51079 NCBI-ProteinID:  NP_057049 OMIM:  609435 HGNC:  17194 Ensembl:  ENSG00000186010 UniProt:  Q9P0J0 Structure PDB LinkDB All DBs Position 19:19516225..19528198 Genome browser AA seq 144 aa AA seqDB search MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL IGELYGLRTTEEALHASHGFMWYT NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgac tacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggatt ggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgccta caaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgac cggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac gtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttg atcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttc atgtggtacacgtag

Homo sapiens (human): 4707 Help Entry 4707              CDS       T01001                                  Symbol NDUFB1, CI-MNLL, CI-SGDH, MNLL Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B1   KO K03957   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4707 (NDUFB1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4707 (NDUFB1)   09159 Environmental adaptation    04714 Thermogenesis     4707 (NDUFB1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4707 (NDUFB1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4707 (NDUFB1)    05012 Parkinson disease     4707 (NDUFB1)    05014 Amyotrophic lateral sclerosis     4707 (NDUFB1)    05016 Huntington disease     4707 (NDUFB1)    05020 Prion disease     4707 (NDUFB1)    05022 Pathways of neurodegeneration - multiple diseases     4707 (NDUFB1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4707 (NDUFB1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4707 (NDUFB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NADH_oxidored Motif Other DBs NCBI-GeneID:  4707 NCBI-ProteinID:  NP_004536 OMIM:  603837 HGNC:  7695 Ensembl:  ENSG00000183648 UniProt:  O75438 Structure PDB LinkDB All DBs Position 14:complement(92116123..92121706) Genome browser AA seq 58 aa AA seqDB search MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atggtgaacttacttcagattgtgcgggaccactgggttcatgttcttgtccctatggga tttgtcattggatgttatttagacagaaagagtgatgaacggctaactgccttccggaac aagagtatgttatttaaaagggaattgcaacccagtgaagaagttacctggaagtaa

Homo sapiens (human): 4708 Help Entry 4708              CDS       T01001                                  Symbol NDUFB2, AGGG, CI-AGGG Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B2   KO K03958   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4708 (NDUFB2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4708 (NDUFB2)   09159 Environmental adaptation    04714 Thermogenesis     4708 (NDUFB2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4708 (NDUFB2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4708 (NDUFB2)    05012 Parkinson disease     4708 (NDUFB2)    05014 Amyotrophic lateral sclerosis     4708 (NDUFB2)    05016 Huntington disease     4708 (NDUFB2)    05020 Prion disease     4708 (NDUFB2)    05022 Pathways of neurodegeneration - multiple diseases     4708 (NDUFB2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4708 (NDUFB2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4708 (NDUFB2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NADH_B2 Motif Other DBs NCBI-GeneID:  4708 NCBI-ProteinID:  NP_004537 OMIM:  603838 HGNC:  7697 Ensembl:  ENSG00000090266 UniProt:  O95178 A4D1T5 Structure PDB LinkDB All DBs Position 7:140696708..140706643 Genome browser AA seq 105 aa AA seqDB search MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEF FSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtccgctctgactcggctggcgtctttcgctcgcgttggaggccgccttttcagaagc ggctgcgcacggactgctggagatggtggagtccgtcatgccggtggtggtgtgcacatt gagccccggtatagacagttcccccagctgaccagatcccaggtgttccagagcgagttc ttcagcggactcatgtggttctggattctctggcgcttttggcatgactcagaagaggtg ctgggtcactttccgtatcctgatccttcccagtggacagatgaagaattaggtatccct cctgatgatgaagactga

Homo sapiens (human): 4709 Help Entry 4709              CDS       T01001                                  Symbol NDUFB3, B12, CI-B12, MC1DN25 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B3   KO K03959   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4709 (NDUFB3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4709 (NDUFB3)   09159 Environmental adaptation    04714 Thermogenesis     4709 (NDUFB3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4709 (NDUFB3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4709 (NDUFB3)    05012 Parkinson disease     4709 (NDUFB3)    05014 Amyotrophic lateral sclerosis     4709 (NDUFB3)    05016 Huntington disease     4709 (NDUFB3)    05020 Prion disease     4709 (NDUFB3)    05022 Pathways of neurodegeneration - multiple diseases     4709 (NDUFB3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4709 (NDUFB3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4709 (NDUFB3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B12 Motif Other DBs NCBI-GeneID:  4709 NCBI-ProteinID:  NP_001244031 OMIM:  603839 HGNC:  7698 Ensembl:  ENSG00000119013 UniProt:  O43676 Structure PDB LinkDB All DBs Position 2:201072001..201085750 Genome browser AA seq 98 aa AA seqDB search MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcccatgaacatggacatgagcatggacatcataaaatggaacttccagattataga caatggaagatagaagggacaccattagaaactatccagaagaagctggctgcaaaaggg ctaagggatccatggggccgcaatgaagcttggagatacatgggtggctttgcaaagagt gtttccttttctgatgtattctttaaaggattcaaatggggatttgctgcatttgtggta gctgtaggagctgaatattacctggagtccctgaataaagataagaagcatcactga

Homo sapiens (human): 4710 Help Entry 4710              CDS       T01001                                  Symbol NDUFB4, B15, CI-B15 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B4   KO K03960   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4710 (NDUFB4)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4710 (NDUFB4)   09159 Environmental adaptation    04714 Thermogenesis     4710 (NDUFB4)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4710 (NDUFB4)   09164 Neurodegenerative disease    05010 Alzheimer disease     4710 (NDUFB4)    05012 Parkinson disease     4710 (NDUFB4)    05014 Amyotrophic lateral sclerosis     4710 (NDUFB4)    05016 Huntington disease     4710 (NDUFB4)    05020 Prion disease     4710 (NDUFB4)    05022 Pathways of neurodegeneration - multiple diseases     4710 (NDUFB4)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4710 (NDUFB4)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4710 (NDUFB4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B4 Motif Other DBs NCBI-GeneID:  4710 NCBI-ProteinID:  NP_004538 OMIM:  603840 HGNC:  7699 Ensembl:  ENSG00000065518 UniProt:  O95168 Structure PDB LinkDB All DBs Position 3:120596336..120602507 Genome browser AA seq 129 aa AA seqDB search MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLI ENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGK LDRTFHLSY NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtcgttcccaaagtataagccgtcgagcctgcgcactctgcctgagaccctcgaccca gccgaatacaacatatctccggaaacccggcgggcgcaagccgagcggttggccataaga gcccagctgaaacgagagtacctgcttcagtacaacgatcccaaccgccgagggctcatc gaaaatcctgccttgcttcgttgggcctatgcaagaacaataaatgtctatcctaatttc agacccactcctaaaaactcactcatgggagctctgtgtggatttgggcccctcatcttc atttattatattatcaaaactgagagggataggaaagaaaaacttatccaggaaggaaaa ttggatcgaacatttcacctctcatattaa

Homo sapiens (human): 4711 Help Entry 4711              CDS       T01001                                  Symbol NDUFB5, CISGDH, SGDH Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B5   KO K03961   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4711 (NDUFB5)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4711 (NDUFB5)   09159 Environmental adaptation    04714 Thermogenesis     4711 (NDUFB5)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4711 (NDUFB5)   09164 Neurodegenerative disease    05010 Alzheimer disease     4711 (NDUFB5)    05012 Parkinson disease     4711 (NDUFB5)    05014 Amyotrophic lateral sclerosis     4711 (NDUFB5)    05016 Huntington disease     4711 (NDUFB5)    05020 Prion disease     4711 (NDUFB5)    05022 Pathways of neurodegeneration - multiple diseases     4711 (NDUFB5)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4711 (NDUFB5)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4711 (NDUFB5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B5 VMA21 Motif Other DBs NCBI-GeneID:  4711 NCBI-ProteinID:  NP_002483 OMIM:  603841 HGNC:  7700 Ensembl:  ENSG00000136521 UniProt:  O43674 Structure PDB LinkDB All DBs Position 3:179604794..179627647 Genome browser AA seq 189 aa AA seqDB search MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPS RFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRW IARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELID HSPKATPDN NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcggccatgagtttgttgcggcgggtttcggttactgcggtggcagctctgtctggc cggccccttggcactcgcctcggatttgggggcttcctcactcgtggctttccgaaggct gctgctcctgttcgacacagtggagaccatgggaaaagactatttgtcatcagaccttct agattctatgacaggcgttttttgaagttattgagattctacattgcattgactgggatt ccagtagcaattttcataactctggtgaatgtattcattggtcaagctgaactagcagaa attccagaaggctatgtcccagaacactgggaatattataagcatcccatatcaagatgg attgcccgtaatttctatgatagtcctgaaaagatatatgaaagaacaatggccgtcctt cagattgaagctgaaaaggctgaattacgggtaaaggagctggaagtgcgaaaattgatg catgtgagaggagatggaccctggtattactatgagacaattgacaaggaacttattgat cattctccgaaagcaactcctgacaattaa

Homo sapiens (human): 4712 Help Entry 4712              CDS       T01001                                  Symbol NDUFB6, B17, CI Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B6   KO K03962   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4712 (NDUFB6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4712 (NDUFB6)   09159 Environmental adaptation    04714 Thermogenesis     4712 (NDUFB6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4712 (NDUFB6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4712 (NDUFB6)    05012 Parkinson disease     4712 (NDUFB6)    05014 Amyotrophic lateral sclerosis     4712 (NDUFB6)    05016 Huntington disease     4712 (NDUFB6)    05020 Prion disease     4712 (NDUFB6)    05022 Pathways of neurodegeneration - multiple diseases     4712 (NDUFB6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4712 (NDUFB6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4712 (NDUFB6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B6 Motif Other DBs NCBI-GeneID:  4712 NCBI-ProteinID:  NP_002484 OMIM:  603322 HGNC:  7701 Ensembl:  ENSG00000165264 UniProt:  O95139 Structure PDB LinkDB All DBs Position 9:complement(32553001..32573159) Genome browser AA seq 128 aa AA seqDB search MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKM VHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPM KEFPDQHH NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgacggggtacactccggatgagaaactgcggctgcagcagctgcgagagctgagaagg cgatggctgaaggaccaggagctgagccctcgggagccggtgctgcccccacagaagatg gggcctatggagaaattctggaataaatttttggagaataaatccccttggaggaaaatg gtccatggggtatacaaaaagagtatctttgttttcactcatgtacttgtacctgtctgg attattcattattacatgaagtatcatgtttctgaaaaaccatatggcatagttgaaaag aagtccagaatattccctggtgatacaattctggagactggagaagtaattccaccaatg aaagaatttcctgatcaacatcattaa

Homo sapiens (human): 4713 Help Entry 4713              CDS       T01001                                  Symbol NDUFB7, B18, CI-B18, MC1DN39 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B7   KO K03963   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4713 (NDUFB7)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4713 (NDUFB7)   09159 Environmental adaptation    04714 Thermogenesis     4713 (NDUFB7)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4713 (NDUFB7)   09164 Neurodegenerative disease    05010 Alzheimer disease     4713 (NDUFB7)    05012 Parkinson disease     4713 (NDUFB7)    05014 Amyotrophic lateral sclerosis     4713 (NDUFB7)    05016 Huntington disease     4713 (NDUFB7)    05020 Prion disease     4713 (NDUFB7)    05022 Pathways of neurodegeneration - multiple diseases     4713 (NDUFB7)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4713 (NDUFB7)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4713 (NDUFB7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B7 OrfB_IS605 Cmc1 Motif Other DBs NCBI-GeneID:  4713 NCBI-ProteinID:  NP_004137 OMIM:  603842 HGNC:  7702 Ensembl:  ENSG00000099795 UniProt:  P17568 Structure PDB LinkDB All DBs Position 19:complement(14566078..14572066) Genome browser AA seq 137 aa AA seqDB search MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA ELAKGQGPGEVDPKVAL NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggcccacctggtccggcgctacctgggcgatgcctcggtggagcccgaccccctg cagatgccaaccttcccgccagactacggcttccccgaacgcaaggagcgcgagatggtg gccacacagcaggagatgatggacgcgcagctgaggctccagctgcgggactactgcgcc caccacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc aagcaggagcggcacgactgggactactgcgagcaccgcgactatgtgatgcgcatgaag gagtttgagcgggagcggaggctgctccagcggaagaagcggcgggagaagaaggcggca gagttggccaaaggccagggacccggggaagtggaccccaaggtggccctgtag

Homo sapiens (human): 4714 Help Entry 4714              CDS       T01001                                  Symbol NDUFB8, ASHI, CI-ASHI, MC1DN32 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B8   KO K03964   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4714 (NDUFB8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4714 (NDUFB8)   09159 Environmental adaptation    04714 Thermogenesis     4714 (NDUFB8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4714 (NDUFB8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4714 (NDUFB8)    05012 Parkinson disease     4714 (NDUFB8)    05014 Amyotrophic lateral sclerosis     4714 (NDUFB8)    05016 Huntington disease     4714 (NDUFB8)    05020 Prion disease     4714 (NDUFB8)    05022 Pathways of neurodegeneration - multiple diseases     4714 (NDUFB8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4714 (NDUFB8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4714 (NDUFB8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B8 Motif Other DBs NCBI-GeneID:  4714 NCBI-ProteinID:  NP_004995 OMIM:  602140 HGNC:  7703 Ensembl:  ENSG00000166136 UniProt:  O95169 Structure PDB LinkDB All DBs Position 10:complement(100523729..100529923) Genome browser AA seq 186 aa AA seqDB search MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVE DYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTS PTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPER VVHYEI NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggcggtggccagggccggggtcttgggagtccagtggctgcaaagggcatcccggaac gtgatgccgctgggcgcacggacagcctcccacatgaccaaggacatgttcccggggccc tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa gactacgaaccttacccggatgatggcatggggtatggcgactacccgaagctccctgac cgctcacagcatgagagagatccatggtatagctgggaccagccgggcctgaggttgaac tggggtgaaccgatgcactggcacctagacatgtacaacaggaaccgtgtggatacatcc cccacacctgtttcttggcatgtcatgtgtatgcagctcttcggtttcctggctttcatg atattcatgtgctgggtgggggacgtgtaccctgtctaccagcctgtgggaccaaagcag tatccttacaataatctgtacctggaacgaggcggtgatccctccaaagaaccagagcgg gtggttcactatgagatctga

Homo sapiens (human): 4715 Help Entry 4715              CDS       T01001                                  Symbol NDUFB9, B22, CI-B22, LYRM3, MC1DN24, UQOR22 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B9   KO K03965   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4715 (NDUFB9)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4715 (NDUFB9)   09159 Environmental adaptation    04714 Thermogenesis     4715 (NDUFB9)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4715 (NDUFB9)   09164 Neurodegenerative disease    05010 Alzheimer disease     4715 (NDUFB9)    05012 Parkinson disease     4715 (NDUFB9)    05014 Amyotrophic lateral sclerosis     4715 (NDUFB9)    05016 Huntington disease     4715 (NDUFB9)    05020 Prion disease     4715 (NDUFB9)    05022 Pathways of neurodegeneration - multiple diseases     4715 (NDUFB9)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4715 (NDUFB9)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4715 (NDUFB9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_LYR Complex1_LYR_2 ImpA_N Motif Other DBs NCBI-GeneID:  4715 NCBI-ProteinID:  NP_004996 OMIM:  601445 HGNC:  7704 Ensembl:  ENSG00000147684 UniProt:  Q9Y6M9 Structure PDB LinkDB All DBs Position 8:124539123..124549979 Genome browser AA seq 179 aa AA seqDB search MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggcgttcttggcgtcgggaccctacctgacccatcagcaaaaggtgttgcggctttat aagcgggcgctacgccacctcgagtcgtggtgcgtccagagagacaaataccgatacttt gcttgtttgatgagagcccggtttgaagaacataagaatgaaaaggatatggcgaaggcc acccagctgctgaaggaggccgaggaagaattctggtaccgtcagcatccacagccatac atcttccctgactctcctgggggcacctcctatgagagatacgattgctacaaggtccca gaatggtgcttagatgactggcatccttctgagaaggcaatgtatcctgattactttgcc aagagagaacagtggaagaaactgcggagggaaagctgggaacgagaggttaagcagctg caggaggaaacgccacctggtggtcctttaactgaagctttgccccctgcccgaaaggaa ggtgatttgcccccactgtggtggtatattgtgaccagaccccgggagcggcccatgtag

Homo sapiens (human): 4716 Help Entry 4716              CDS       T01001                                  Symbol NDUFB10, MC1DN35, PDSW Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B10   KO K03966   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4716 (NDUFB10)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4716 (NDUFB10)   09159 Environmental adaptation    04714 Thermogenesis     4716 (NDUFB10)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4716 (NDUFB10)   09164 Neurodegenerative disease    05010 Alzheimer disease     4716 (NDUFB10)    05012 Parkinson disease     4716 (NDUFB10)    05014 Amyotrophic lateral sclerosis     4716 (NDUFB10)    05016 Huntington disease     4716 (NDUFB10)    05020 Prion disease     4716 (NDUFB10)    05022 Pathways of neurodegeneration - multiple diseases     4716 (NDUFB10)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4716 (NDUFB10)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4716 (NDUFB10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFB10 Motif Other DBs NCBI-GeneID:  4716 NCBI-ProteinID:  NP_004539 OMIM:  603843 HGNC:  7696 Ensembl:  ENSG00000140990 UniProt:  O96000 A8K761 Structure PDB LinkDB All DBs Position 16:1959538..1961975 Genome browser AA seq 172 aa AA seqDB search MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgccggacagctgggacaaggatgtgtaccctgagcccccgcgccgcacgccggtgcag cccaatcccatcgtctacatgatgaaagcgttcgacctcatcgtggaccgacccgtgacc ctcgtgagagaatttatagagcggcagcacgcaaagaacaggtattactactaccaccgg cagtaccgccgcgtgccagacatcactgagtgcaaggaggaggacatcatgtgcatgtat gaagccgaaatgcagtggaagagggactacaaagtcgaccaagaaattatcaacattatg caggatcggctcaaagcctgtcagcagagggaaggacagaactaccagcagaactgtatc aaggaagtggagcagttcacccaggtggccaaggcctaccaggaccgctatcaggacctg ggggcctacagttctgccaggaagtgcctggccaaacagaggcagaggatgctgcaagag agaaaagctgcaaaagaggccgccgctgccacctcctga

Homo sapiens (human): 54539 Help Entry 54539             CDS       T01001                                  Symbol NDUFB11, CI-ESSS, ESSS, MC1DN30, NP17.3, Np15, P17.3 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B11   KO K11351   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01904   Microphthalmia with linear skin defects syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     54539 (NDUFB11)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     54539 (NDUFB11)   09159 Environmental adaptation    04714 Thermogenesis     54539 (NDUFB11)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     54539 (NDUFB11)   09164 Neurodegenerative disease    05010 Alzheimer disease     54539 (NDUFB11)    05012 Parkinson disease     54539 (NDUFB11)    05014 Amyotrophic lateral sclerosis     54539 (NDUFB11)    05016 Huntington disease     54539 (NDUFB11)    05020 Prion disease     54539 (NDUFB11)    05022 Pathways of neurodegeneration - multiple diseases     54539 (NDUFB11)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     54539 (NDUFB11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     54539 (NDUFB11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ESSS Motif Other DBs NCBI-GeneID:  54539 NCBI-ProteinID:  NP_001129470 OMIM:  300403 HGNC:  20372 Ensembl:  ENSG00000147123 UniProt:  Q9NX14 Structure PDB LinkDB All DBs Position X:complement(47142216..47145491) Genome browser AA seq 153 aa AA seqDB search MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPE PEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRR EAERLVKYREANGLPIMESNCFDPSKIQLPEDE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcggctgggctgtttggtttgagcgctcgccgtcttttggcggcagcggcgacgcga gggctcccggccgcccgcgtccgctgggaatctagcttctccaggactgtggtcgccccg tccgctgtggcgggaaagcggcccccagaaccgaccacaccgtggcaagaggacccagaa cccgaggacgaaaacttgtatgagaagaacccagactcccatggttatgacaaggacccc gttttggacgtctggaacatgcgacttgtcttcttctttggcgtctccatcatcctggtc cttggcagcacctttgtggcctatctgcctgactacaggatgaaagagtggtcccgccgc gaagctgagaggcttgtgaaataccgagaggccaatggccttcccatcatggaatccaac tgcttcgaccccagcaagatccagctgccagaggatgagtga

Homo sapiens (human): 4717 Help Entry 4717              CDS       T01001                                  Symbol NDUFC1, KFYI Name (RefSeq) NADH:ubiquinone oxidoreductase subunit C1   KO K03967   NADH dehydrogenase (ubiquinone) 1 subunit C1 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4717 (NDUFC1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4717 (NDUFC1)   09159 Environmental adaptation    04714 Thermogenesis     4717 (NDUFC1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4717 (NDUFC1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4717 (NDUFC1)    05012 Parkinson disease     4717 (NDUFC1)    05014 Amyotrophic lateral sclerosis     4717 (NDUFC1)    05016 Huntington disease     4717 (NDUFC1)    05020 Prion disease     4717 (NDUFC1)    05022 Pathways of neurodegeneration - multiple diseases     4717 (NDUFC1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4717 (NDUFC1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4717 (NDUFC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NADH_dh_m_C1 Motif Other DBs NCBI-GeneID:  4717 NCBI-ProteinID:  NP_001171915 OMIM:  603844 HGNC:  7705 Ensembl:  ENSG00000109390 UniProt:  O43677 Structure PDB LinkDB All DBs Position 4:complement(139289917..139302551) Genome browser AA seq 76 aa AA seqDB search MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIK QHNEDILEYKRRNGLE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgccgtccgccttgctgcgtcccctttcccggctgctggcccccgccaggctcccg agcggcccttcagtgcgatcaaagttctacgtgcgagagccgccgaatgccaaacctgac tggctgaaagttgggttcaccttgggcaccactgtcttcttgtggatctatctcatcaaa caacacaatgaagatattttagagtacaaaagaagaaatgggctggaataa

Homo sapiens (human): 4718 Help Entry 4718              CDS       T01001                                  Symbol NDUFC2, B14.5b, CI-B14.5b, HLC-1, MC1DN36, NADHDH2 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit C2   KO K03968   NADH dehydrogenase (ubiquinone) 1 subunit C2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4718 (NDUFC2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4718 (NDUFC2)   09159 Environmental adaptation    04714 Thermogenesis     4718 (NDUFC2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4718 (NDUFC2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4718 (NDUFC2)    05012 Parkinson disease     4718 (NDUFC2)    05014 Amyotrophic lateral sclerosis     4718 (NDUFC2)    05016 Huntington disease     4718 (NDUFC2)    05020 Prion disease     4718 (NDUFC2)    05022 Pathways of neurodegeneration - multiple diseases     4718 (NDUFC2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4718 (NDUFC2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4718 (NDUFC2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_C2 HL_N-beta Motif Other DBs NCBI-GeneID:  4718 NCBI-ProteinID:  NP_004540 OMIM:  603845 HGNC:  7706 Ensembl:  ENSG00000151366 UniProt:  O95298 Structure PDB LinkDB All DBs Position 11:complement(78068297..78079862) Genome browser AA seq 119 aa AA seqDB search MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt cctgaagaagataagaaaacatatggtgaaatttttgaaaaattccatccaatacgttga

DBGET integrated database retrieval system