Homo sapiens (human): 4719 Help Entry 4719              CDS       T01001                                  Symbol NDUFS1, CI-75Kd, CI-75k, MC1DN5, PRO1304 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S1   KO K03934   NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4719 (NDUFS1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4719 (NDUFS1)   09159 Environmental adaptation    04714 Thermogenesis     4719 (NDUFS1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4719 (NDUFS1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4719 (NDUFS1)    05012 Parkinson disease     4719 (NDUFS1)    05014 Amyotrophic lateral sclerosis     4719 (NDUFS1)    05016 Huntington disease     4719 (NDUFS1)    05020 Prion disease     4719 (NDUFS1)    05022 Pathways of neurodegeneration - multiple diseases     4719 (NDUFS1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4719 (NDUFS1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4719 (NDUFS1) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4719 (NDUFS1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Molybdopterin Fer2_4 NADH-G_4Fe-4S_3 NADH_dhqG_C Fer2 Motif Other DBs NCBI-GeneID:  4719 NCBI-ProteinID:  NP_004997 OMIM:  157655 HGNC:  7707 Ensembl:  ENSG00000023228 UniProt:  P28331 E5KRK5 Structure PDB LinkDB All DBs Position 2:complement(206114817..206159444) Genome browser AA seq 727 aa AA seqDB search MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA VEEPSIC NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt atgttaaggatacctgtaagaaaggccttagtaggcctttctaagtctcctaaaggatgt gttcgaacaactgccacagcagcaagcaacttgattgaagtatttgttgatggtcagtct gtcatggtggaaccgggaacgaccgtcctccaagcttgtgagaaggttggcatgcagatc cctcgattctgttatcatgaaaggttgtctgttgctggaaactgcaggatgtgccttgtt gaaattgagaaagcccctaaggttgtagctgcttgtgccatgccagtaatgaagggttgg aatatcctaacaaactcagaaaaatccaaaaaagccagggaaggtgtgatggagttctta ttagcaaatcacccattggactgtcctatttgtgaccagggaggtgaatgtgatctgcag gaccagtccatgatgtttggaaatgataggagccgatttttagaggggaagcgtgctgtg gaagacaagaacattgggccattggtaaagaccatcatgacaagatgtatacagtgtact cgctgcatcaggtttgcaagtgagattgcaggagtagatgatttgggaacaacaggcaga ggaaatgatatgcaagttggcacatacattgaaaagatgttcatgtctgaactgtctggg aatatcattgatatctgccctgtaggtgccctaacctctaagccctatgcctttactgcc cggccttgggaaacaagaaagacagaatccattgatgtaatggatgcggttggaagtaat attgtggttagcacaagaactggagaagtgatgaggattttgccacgtatgcatgaggac atcaatgaagagtggatctctgataaaaccagatttgcctatgatgggctaaaacgtcaa agacttaccgagccaatggtcagaaatgaaaaagggcttttaacctatacttcttgggag gatgcgctctctcgcgtagctggaatgttgcagagttttcaaggcaaagatgtggcagca attgcaggtggcttggtggatgctgaagccctggtagctctcaaagatttgcttaataga gtggactctgacaccttatgcactgaagaggtcttccccactgcaggagctggcacagat ttgcgttccaattatcttcttaatactacaattgctggtgtggaagaggcagatgttgtt cttctggttggtacaaacccacgttttgaggcaccactgtttaatgctagaattcgaaag agctggctgcataatgacttaaaagtggcccttataggcagtccagtggacctcacttac acatatgaccacctgggagactcccccaaaattcttcaagacattgcttcgggaagccat ccatttagccaggtcctaaaggaagctaaaaaaccaatggtggttttaggcagttctgca ctccaaagaaatgatggagcagcaattcttgcagctgtttctagcattgcacaaaagatt cggatgactagtggtgttactggtgattggaaagttatgaatatccttcataggattgca agtcaagtagctgctttggaccttggctataagcctggggtggaagcaattcggaagaac cctcccaaggtgctgtttctcctgggagcagatggaggttgtatcacacgacaggatttg ccaaaggattgtttcattatttatcaaggacatcatggtgatgttggggctcccatagct gatgttattctcccaggagctgcttacacagagaagtctgctacatatgtcaacactgag ggtagagctcagcagactaaggtagcagtgacacctcctggcttggcaagagaagactgg aaaattataagagcactctctgagattgctggaatgactcttccatatgatactctggat caagtaaggaacagattggaagaagtctctcctaatcttgttcgatatgatgatattgaa ggggctaattacttccagcaagcaaatgagctctcaaagctagtgaaccagcagcttctt gctgacccacttgttccacctcagctaactataaaagacttctacatgacagattcaatt agcagagcctcacagacaatggccaaatgtgtcaaagctgtcacagagggtgcccaggca gtagaggaaccatccatatgctga

Homo sapiens (human): 4720 Help Entry 4720              CDS       T01001                                  Symbol NDUFS2, CI-49, LHONAR2, MC1DN6 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S2   KO K03935   NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4720 (NDUFS2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4720 (NDUFS2)   09159 Environmental adaptation    04714 Thermogenesis     4720 (NDUFS2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4720 (NDUFS2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4720 (NDUFS2)    05012 Parkinson disease     4720 (NDUFS2)    05014 Amyotrophic lateral sclerosis     4720 (NDUFS2)    05016 Huntington disease     4720 (NDUFS2)    05020 Prion disease     4720 (NDUFS2)    05022 Pathways of neurodegeneration - multiple diseases     4720 (NDUFS2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4720 (NDUFS2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4720 (NDUFS2) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4720 (NDUFS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_49kDa NiFeSe_Hases Motif Other DBs NCBI-GeneID:  4720 NCBI-ProteinID:  NP_004541 OMIM:  602985 HGNC:  7708 Ensembl:  ENSG00000158864 UniProt:  O75306 Structure PDB LinkDB All DBs Position 1:161197417..161214395 Genome browser AA seq 463 aa AA seqDB search MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAH WKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRL LNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL MDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQW DLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDD AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctgagggctttgtgcggcttccggggcgtcgcggcccaggtgctgcggcct ggggctggagtccgattgccgattcagcccagcagaggtgttcggcagtggcagccagat gtggaatgggcacagcagtttgggggagctgttatgtacccaagcaaagaaacagcccac tggaagcctccaccttggaatgatgtggaccctccaaaggacacaattgtgaagaacatt accctgaactttgggccccaacacccagcagcgcatggtgtcctgcgactagtgatggaa ttgagtggggagatggtgcggaagtgtgatcctcacatcgggctcctgcaccgaggcact gagaagctcattgaatacaagacctatcttcaggcccttccatactttgaccggctagac tatgtgtccatgatgtgtaacgaacaggcctattctctagctgtggagaagttgctaaac atccggcctcctcctcgggcacagtggatccgagtgctgtttggagaaatcacacgtttg ttgaaccacatcatggctgtgaccacacatgccctggaccttggggccatgacccctttc ttctggctgtttgaagaaagggagaagatgtttgagttctacgagcgagtgtctggagcc cgaatgcatgctgcttatatccggccaggaggagtgcaccaggacctaccccttgggctt atggatgacatttatcagttttctaagaacttctctcttcggcttgatgagttggaggag ttgctgaccaacaataggatctggcgaaatcggacaattgacattggggttgtaacagca gaagaagcacttaactatggttttagtggagtgatgcttcggggctcaggcatccagtgg gacctgcggaagacccagccctatgatgtttacgaccaggttgagtttgatgttcctgtt ggttctcgaggggactgctatgataggtacctgtgccgggtggaggagatgcgccagtcc ctgagaattatcgcacagtgtctaaacaagatgcctcctggggagatcaaggttgatgat gccaaagtgtctccacctaagcgagcagagatgaagacttccatggagtcactgattcat cactttaagttgtatactgagggctaccaagttcctccaggagccacatatactgccatt gaggctcccaagggagagtttggggtgtacctggtgtctgatggcagcagccgcccttat cgatgcaagatcaaggctcctggttttgcccatctggctggtttggacaagatgtctaag ggacacatgttggcagatgtcgttgccatcataggtacccaagatattgtatttggagaa gtagatcggtga

Homo sapiens (human): 4722 Help Entry 4722              CDS       T01001                                  Symbol NDUFS3, CI-30, MC1DN8 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S3   KO K03936   NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4722 (NDUFS3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4722 (NDUFS3)   09159 Environmental adaptation    04714 Thermogenesis     4722 (NDUFS3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4722 (NDUFS3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4722 (NDUFS3)    05012 Parkinson disease     4722 (NDUFS3)    05014 Amyotrophic lateral sclerosis     4722 (NDUFS3)    05016 Huntington disease     4722 (NDUFS3)    05020 Prion disease     4722 (NDUFS3)    05022 Pathways of neurodegeneration - multiple diseases     4722 (NDUFS3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4722 (NDUFS3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4722 (NDUFS3) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4722 (NDUFS3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_30kDa Motif Other DBs NCBI-GeneID:  4722 NCBI-ProteinID:  NP_004542 OMIM:  603846 HGNC:  7710 Ensembl:  ENSG00000213619 UniProt:  O75489 Structure PDB LinkDB All DBs Position 11:47579074..47584562 Genome browser AA seq 264 aa AA seqDB search MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSA FGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVP TRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFAN HPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWE AFPVYRQPPESLKLEAGDKKPDAK NT seq 795 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggtagccaggctgtggtggcgcgggatcttgggggcctcggcgctg accagggggactgggcgaccctccgttctgttgctgccggtgaggcgggagagcgccggg gccgacacgcgccccactgtcagaccacggaatgatgtggcccacaagcagctctcagct tttggagagtatgtggctgaaatcttgcccaagtatgtccaacaagttcaggtgtcctgc ttcaatgagttagaggtctgtatccatcctgatggcgtcatcccagtgctgactttcctc agggatcacaccaatgcacagttcaaatctctggttgacttgacagcagtggacgtccca actcggcaaaaccgttttgagattgtctacaacctgttgtctctgcgcttcaactcacgg atccgtgtgaagacctacacagatgagctgacgcccattgagtctgctgtctctgtgttc aaggcagccaactggtatgaaagggagatctgggacatgtttggagtcttctttgctaac caccctgatctaagaaggatcctgacagattatggcttcgagggacatcctttccggaaa gactttcctctatctggctatgttgagttacgttatgatgatgaagtgaagcgggtggtg gcagagccggtggagttggcccaagagttccgcaaatttgacctgaacagcccctgggag gctttcccagtctatcgccaacccccggagagtctcaagcttgaagccggagacaagaag cctgatgccaagtag

Homo sapiens (human): 4724 Help Entry 4724              CDS       T01001                                  Symbol NDUFS4, AQDQ, CI-18, CI-18_kDa, CI-AQDQ, MC1DN1 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit S4   KO K03937   NADH dehydrogenase (ubiquinone) Fe-S protein 4 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4724 (NDUFS4)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4724 (NDUFS4)   09159 Environmental adaptation    04714 Thermogenesis     4724 (NDUFS4)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4724 (NDUFS4)   09164 Neurodegenerative disease    05010 Alzheimer disease     4724 (NDUFS4)    05012 Parkinson disease     4724 (NDUFS4)    05014 Amyotrophic lateral sclerosis     4724 (NDUFS4)    05016 Huntington disease     4724 (NDUFS4)    05020 Prion disease     4724 (NDUFS4)    05022 Pathways of neurodegeneration - multiple diseases     4724 (NDUFS4)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4724 (NDUFS4)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4724 (NDUFS4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUS4 CSN8_PSD8_EIF3K Motif Other DBs NCBI-GeneID:  4724 NCBI-ProteinID:  NP_002486 OMIM:  602694 HGNC:  7711 Ensembl:  ENSG00000164258 UniProt:  O43181 A0A0S2Z433 Structure PDB LinkDB All DBs Position 5:53560639..53683338 Genome browser AA seq 175 aa AA seqDB search MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLD ITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP LSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggcggcggtgtcaatgtcagtggtactgaggcagacgttgtggcggagaagggcagtg gctgtagctgccctttccgtttccagggttccgaccaggtcgttgaggacttccacatgg agattggcacaggaccagactcaagacacacaactcataacagttgatgaaaaattggat atcactactttaactggagttccagaagagcatataaaaactagaaaagtcaggatcttt gttcctgctcgcaataacatgcagtctggagtaaacaacacaaagaaatggaagatggag tttgataccagagagcgatgggaaaatcctttgatgggttgggcatcaacggctgatccc ttatccaacatggttctaaccttcagtactaaagaagatgcagtttcctttgcagaaaaa aatggatggagctatgacattgaagagaggaaggttccaaaacccaagtccaagtcttat ggtgcaaacttttcttggaacaaaagaacaagagtatccacaaaatag

Homo sapiens (human): 4726 Help Entry 4726              CDS       T01001                                  Symbol NDUFS6, CI-13kA, CI-13kD-A, CI13KDA, MC1DN9 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit S6   KO K03939   NADH dehydrogenase (ubiquinone) Fe-S protein 6 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4726 (NDUFS6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4726 (NDUFS6)   09159 Environmental adaptation    04714 Thermogenesis     4726 (NDUFS6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4726 (NDUFS6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4726 (NDUFS6)    05012 Parkinson disease     4726 (NDUFS6)    05014 Amyotrophic lateral sclerosis     4726 (NDUFS6)    05016 Huntington disease     4726 (NDUFS6)    05020 Prion disease     4726 (NDUFS6)    05022 Pathways of neurodegeneration - multiple diseases     4726 (NDUFS6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4726 (NDUFS6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4726 (NDUFS6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-CHCC Thiolase_C Motif Other DBs NCBI-GeneID:  4726 NCBI-ProteinID:  NP_004544 OMIM:  603848 HGNC:  7713 Ensembl:  ENSG00000145494 UniProt:  O75380 Q6IBC4 Structure PDB LinkDB All DBs Position 5:1801407..1816048 Genome browser AA seq 124 aa AA seqDB search MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR QHHH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatgaccttctgccggctgctgaaccggtgtggcgaggcggcgcggagc ctgcccctgggcgccaggtgtttcggggtgcgggtctcgccgaccggggagaaggtcacg cacactggccaggtttatgatgataaagactacaggagaattcggtttgtaggtcgtcag aaagaggtgaatgaaaactttgccattgatttgatagcagagcagcccgtgagcgaggtg gagactcgggtgatagcgtgcgatggcggcgggggagctcttggccacccaaaagtgtat ataaacttggacaaagaaacaaaaaccggcacatgcggttactgtgggctccagttcaga cagcaccaccactag

Homo sapiens (human): 374291 Help Entry 374291            CDS       T01001                                  Symbol NDUFS7, CI-20, CI-20KD, MC1DN3, MY017, PSST Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S7   KO K03940   NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     374291 (NDUFS7)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     374291 (NDUFS7)   09159 Environmental adaptation    04714 Thermogenesis     374291 (NDUFS7)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     374291 (NDUFS7)   09164 Neurodegenerative disease    05010 Alzheimer disease     374291 (NDUFS7)    05012 Parkinson disease     374291 (NDUFS7)    05014 Amyotrophic lateral sclerosis     374291 (NDUFS7)    05016 Huntington disease     374291 (NDUFS7)    05020 Prion disease     374291 (NDUFS7)    05022 Pathways of neurodegeneration - multiple diseases     374291 (NDUFS7)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     374291 (NDUFS7)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     374291 (NDUFS7) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      374291 (NDUFS7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q6 Secapin Motif Other DBs NCBI-GeneID:  374291 NCBI-ProteinID:  NP_077718 OMIM:  601825 HGNC:  7714 Ensembl:  ENSG00000115286 UniProt:  O75251 Q7LD69 Structure PDB LinkDB All DBs Position 19:1383907..1395584 Genome browser AA seq 213 aa AA seqDB search MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcggtgctgtcagctcctggcctgcgcggcttccggatccttggtctgcgctccagc gtgggcccggctgtgcaggcacgaggtgtccatcagagcgtggccaccgatggcccaagc agcacccagcctgccctgccaaaggccagagccgtggctcccaaacccagcagccggggc gagtatgtggtggccaagctggatgacctcgtcaactgggcccgccggagttctctgtgg cccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcagcaccccgc tacgacatggaccgctttggcgtggtcttccgcgccagcccgcgccagtccgacgtcatg atcgtggccggcacactcaccaacaagatggccccagcgcttcgcaaggtctacgaccag atgccggagccgcgctacgtggtctccatggggagctgcgccaacggaggaggctactac cactattcctactcggtggtgaggggctgcgaccgcatcgtgcccgtggacatctacatc ccaggctgcccacctacggccgaggccctgctctacggcatcctgcagctgcagaggaag atcaagcgggagcggaggctgcagatctggtaccgcaggtag

Homo sapiens (human): 4728 Help Entry 4728              CDS       T01001                                  Symbol NDUFS8, CI-23k, CI23KD, MC1DN2, TYKY Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit S8   KO K03941   NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4728 (NDUFS8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4728 (NDUFS8)   09159 Environmental adaptation    04714 Thermogenesis     4728 (NDUFS8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4728 (NDUFS8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4728 (NDUFS8)    05012 Parkinson disease     4728 (NDUFS8)    05014 Amyotrophic lateral sclerosis     4728 (NDUFS8)    05016 Huntington disease     4728 (NDUFS8)    05020 Prion disease     4728 (NDUFS8)    05022 Pathways of neurodegeneration - multiple diseases     4728 (NDUFS8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4728 (NDUFS8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4728 (NDUFS8) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4728 (NDUFS8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_6 Fer4_9 Fer4_10 Fer4_8 Fer4_2 Fer4_4 Fer4_17 Fer4_3 Motif Other DBs NCBI-GeneID:  4728 NCBI-ProteinID:  NP_002487 OMIM:  602141 HGNC:  7715 Ensembl:  ENSG00000110717 UniProt:  O00217 Structure PDB LinkDB All DBs Position 11:68030681..68036644 Genome browser AA seq 210 aa AA seqDB search MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLL WTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAI CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE LLYNKEKLLNNGDKWEAEIAANIQADYLYR NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgcgctgcctgaccacgcctatgctgctgcgggccctggcccaggctgcacgtgcagga cctcctggtggccggagcctccacagcagtgcagtggcagccacctacaagtatgtgaac atgcaggatcccgagatggacatgaagtcagtgactgaccgggcagcccgcaccctgctg tggactgagctcttccgaggcctgggcatgaccctgagctacctgttccgggaaccggcc accatcaactacccgttcgagaagggcccgctgagccctcgcttccgtggggagcatgcg ctgcgccggtacccatccggggaggagcgttgcattgcctgcaagctctgcgaggccatc tgccccgcccaggccatcaccatcgaggctgagccaagagctgatggcagccgccggacc acccgctatgacatcgacatgaccaagtgcatctactgcggcttctgccaggaggcctgt cccgtggatgccatcgtcgagggccccaactttgagttctccacggagacccatgaggag ctgctgtacaacaaggagaagttgctcaacaacggggacaagtgggaggccgagatcgcc gccaacatccaggctgactacttgtatcggtga

Homo sapiens (human): 4723 Help Entry 4723              CDS       T01001                                  Symbol NDUFV1, CI-51K, CI51KD, MC1DN4, UQOR1 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit V1   KO K03942   NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4723 (NDUFV1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4723 (NDUFV1)   09159 Environmental adaptation    04714 Thermogenesis     4723 (NDUFV1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4723 (NDUFV1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4723 (NDUFV1)    05012 Parkinson disease     4723 (NDUFV1)    05014 Amyotrophic lateral sclerosis     4723 (NDUFV1)    05016 Huntington disease     4723 (NDUFV1)    05020 Prion disease     4723 (NDUFV1)    05022 Pathways of neurodegeneration - multiple diseases     4723 (NDUFV1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4723 (NDUFV1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4723 (NDUFV1) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4723 (NDUFV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_51K NADH_4Fe-4S SLBB Motif Other DBs NCBI-GeneID:  4723 NCBI-ProteinID:  NP_009034 OMIM:  161015 HGNC:  7716 Ensembl:  ENSG00000167792 UniProt:  P49821 E5KNH5 Structure PDB LinkDB All DBs Position 11:67606936..67612554 Genome browser AA seq 464 aa AA seqDB search MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgctggcaacacggcggctgctcggctggtcgcttcccgcgcgggtatctgtgcgtttc agcggcgacacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg attttcaccaacctgtacggccgccatgactggaggctgaaaggttccctgagtcgaggt gactggtacaagacaaaggagatcctgctgaaggggcccgactggatcctgggcgagatc aagacatcgggtttgaggggccgtggaggcgctggcttccccactggcctcaagtggagc ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaacgcagacgagggg gagccgggcacctgcaaggaccgggagatcttacgccatgatcctcacaagctgctggaa ggctgcctggtggggggccgggccatgggcgcccgcgctgcctatatctacatccgaggg gaattctacaatgaggcctccaatctgcaggtggccatccgagaggcctatgaggcaggt ctgattggcaagaatgcttgtggctctggctatgattttgacgtgtttgtggtgcgcggg gctggggcctacatctgtggagaggagacagcgctcatcgagtccattgagggcaagcag ggcaagccccgcctgaagccccccttccccgcagacgtgggagtgtttggctgccccaca actgtggccaacgtggagacagtggcagtgtcccccacaatctgccgccgtggaggtacc tggtttgctggctttggcagagaacgcaactcaggcaccaaactattcaacatctctggc catgtcaaccacccttgcactgtggaggaggagatgtctgtgcccttgaaagaactgatt gagaagcatgctgggggtgtcacgggcggctgggacaacctccttgctgtgatccctggc ggctcgtctaccccactgatccccaagtctgtgtgtgagacggtgctgatggacttcgat gcgctggtgcaggcacagacaggcctgggcacagctgcggtgatcgtcatggaccgctcg acggacatcgtgaaagccatcgcccgcctcattgagttctataagcacgagagctgtggc cagtgtaccccatgccgtgagggtgtggactggatgaacaaggtgatggcacgtttcgtg aggggggatgcccggccggccgagatcgactccctgtgggagatcagcaagcagatagaa ggccatacgatttgtgctctgggtgacggggccgcctggcctgtgcagggtctgatccgc cactttcggccggagctcgaggagcggatgcagcggtttgcccagcagcatcaggcccgg caggctgcctcttag

Homo sapiens (human): 4729 Help Entry 4729              CDS       T01001                                  Symbol NDUFV2, CI-24k, MC1DN7 Name (RefSeq) NADH:ubiquinone oxidoreductase core subunit V2   KO K03943   NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2] Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00143   NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4729 (NDUFV2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4729 (NDUFV2)   09159 Environmental adaptation    04714 Thermogenesis     4729 (NDUFV2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4729 (NDUFV2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4729 (NDUFV2)    05012 Parkinson disease     4729 (NDUFV2)    05014 Amyotrophic lateral sclerosis     4729 (NDUFV2)    05016 Huntington disease     4729 (NDUFV2)    05020 Prion disease     4729 (NDUFV2)    05022 Pathways of neurodegeneration - multiple diseases     4729 (NDUFV2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4729 (NDUFV2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4729 (NDUFV2) Enzymes [BR:hsa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4729 (NDUFV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  2Fe-2S_thioredx Motif Other DBs NCBI-GeneID:  4729 NCBI-ProteinID:  NP_066552 OMIM:  600532 HGNC:  7717 Ensembl:  ENSG00000178127 UniProt:  P19404 Structure PDB LinkDB All DBs Position 18:9102699..9134341 Genome browser AA seq 249 aa AA seqDB search MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atgttcttctccgcggcgctccgggcccgggcggctggcctcaccgcccactggggaaga catgtaaggaatttgcataagacagttatgcaaaatggagctggaggagctttatttgtg cacagagatactcctgagaataaccctgatactccatttgatttcacaccagaaaactat aagaggatagaggcaattgtaaaaaactatccagaaggccataaagcagcagctgttctt ccagtcctggatttagcccaaaggcagaatgggtggttgcccatctctgctatgaacaag gttgcagaagttttacaagtacctccaatgagagtatatgaagtagcaactttttataca atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccctgc atgcttcgaaactctgacagcatactggaggccattcagaaaaagcttggaataaaggtt ggggagactacacctgacaaacttttcactcttatagaagtggaatgtttaggggcctgt gtgaacgcaccaatggttcaaataaatgacaattactatgaggatttgacagctaaggat attgaagaaattattgatgagctcaaggctggcaaaatcccaaaaccagggccaaggagt ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaggga cctggatttggtgtacaagcaggcctttaa

Homo sapiens (human): 4694 Help Entry 4694              CDS       T01001                                  Symbol NDUFA1, CI-MWFE, MC1DN12, MWFE, ZNF183 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A1   KO K03945   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4694 (NDUFA1)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4694 (NDUFA1)   09159 Environmental adaptation    04714 Thermogenesis     4694 (NDUFA1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4694 (NDUFA1)   09164 Neurodegenerative disease    05010 Alzheimer disease     4694 (NDUFA1)    05012 Parkinson disease     4694 (NDUFA1)    05014 Amyotrophic lateral sclerosis     4694 (NDUFA1)    05016 Huntington disease     4694 (NDUFA1)    05020 Prion disease     4694 (NDUFA1)    05022 Pathways of neurodegeneration - multiple diseases     4694 (NDUFA1)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4694 (NDUFA1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4694 (NDUFA1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MWFE Motif Other DBs NCBI-GeneID:  4694 NCBI-ProteinID:  NP_004532 OMIM:  300078 HGNC:  7683 Ensembl:  ENSG00000125356 UniProt:  O15239 Q6IBB5 Structure PDB LinkDB All DBs Position X:119871832..119876662 Genome browser AA seq 70 aa AA seqDB search MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY YVSKGLENID NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtggttcgagattctccccggactctccgtcatgggcgtgtgcttgttgattccagga ctggctactgcgtacatccacaggttcactaacgggggcaaggaaaaaagggttgctcat tttgggtatcactggagtctgatggaaagagataggcgcatctctggagttgatcgttac tatgtgtcaaagggtttggagaacattgattaa

Homo sapiens (human): 4695 Help Entry 4695              CDS       T01001                                  Symbol NDUFA2, B8, CD14, CIB8, MC1DN13 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A2   KO K03946   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4695 (NDUFA2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4695 (NDUFA2)   09159 Environmental adaptation    04714 Thermogenesis     4695 (NDUFA2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4695 (NDUFA2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4695 (NDUFA2)    05012 Parkinson disease     4695 (NDUFA2)    05014 Amyotrophic lateral sclerosis     4695 (NDUFA2)    05016 Huntington disease     4695 (NDUFA2)    05020 Prion disease     4695 (NDUFA2)    05022 Pathways of neurodegeneration - multiple diseases     4695 (NDUFA2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4695 (NDUFA2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4695 (NDUFA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  L51_S25_CI-B8 Motif Other DBs NCBI-GeneID:  4695 NCBI-ProteinID:  NP_002479 OMIM:  602137 HGNC:  7685 Ensembl:  ENSG00000131495 UniProt:  O43678 Structure PDB LinkDB All DBs Position 5:complement(140645285..140647630) Genome browser AA seq 99 aa AA seqDB search MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcggcggccgcagcaagtcgaggagtcggggcaaagctgggcctgcgtgagattcgc atccacttatgtcagcgctcgcccggcagccagggcgtcagggacttcattgagaaacgc tacgtggagctgaagaaggcgaatcccgacctacccatcctaatccgcgaatgctccgat gtgcagcccaagctctgggcccgctacgcatttggccaagagacgaatgtccctttgaac aacttcagtgctgatcaggtaaccagagccctggagaacgttctaagtggtaaagcctga

Homo sapiens (human): 4700 Help Entry 4700              CDS       T01001                                  Symbol NDUFA6, B14, CI-B14, LYRM6, MC1DN33, NADHB14 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A6   KO K03950   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4700 (NDUFA6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4700 (NDUFA6)   09159 Environmental adaptation    04714 Thermogenesis     4700 (NDUFA6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4700 (NDUFA6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4700 (NDUFA6)    05012 Parkinson disease     4700 (NDUFA6)    05014 Amyotrophic lateral sclerosis     4700 (NDUFA6)    05016 Huntington disease     4700 (NDUFA6)    05020 Prion disease     4700 (NDUFA6)    05022 Pathways of neurodegeneration - multiple diseases     4700 (NDUFA6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4700 (NDUFA6)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4700 (NDUFA6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_LYR Complex1_LYR_2 GH115_C Motif Other DBs NCBI-GeneID:  4700 NCBI-ProteinID:  NP_002481 OMIM:  602138 HGNC:  7690 Ensembl:  ENSG00000184983 UniProt:  P56556 A0A2Y9D025 Structure PDB LinkDB All DBs Position 22:complement(42085526..42090772) Genome browser AA seq 128 aa AA seqDB search MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGR DKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLS KFYVGHDP NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggcggggagcggcgtccgccaagctacttctaccgccagcaccttcgtgaagcccatt ttcagtcgggacatgaacgaggccaagcggagggtgcgcgagctctaccgcgcctggtat cgggaggtgccgaacactgtgcaccaattccagctggacatcactgtgaaaatgggacgg gataaagtccgagaaatgtttatgaagaatgcccatgtcacagaccccagggtggttgat cttctggtcattaagggaaagatcgaactggaagaaacaattaaagtatggaagcagcgg acacatgttatgcggttcttccatgaaacagaagcgccaaggccaaaggatttcctatcc aagttctatgttggccacgatccatga

Homo sapiens (human): 4702 Help Entry 4702              CDS       T01001                                  Symbol NDUFA8, CI-19KD, CI-PGIV, MC1DN37, PGIV Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A8   KO K03952   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4702 (NDUFA8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4702 (NDUFA8)   09159 Environmental adaptation    04714 Thermogenesis     4702 (NDUFA8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4702 (NDUFA8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4702 (NDUFA8)    05012 Parkinson disease     4702 (NDUFA8)    05014 Amyotrophic lateral sclerosis     4702 (NDUFA8)    05016 Huntington disease     4702 (NDUFA8)    05020 Prion disease     4702 (NDUFA8)    05022 Pathways of neurodegeneration - multiple diseases     4702 (NDUFA8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4702 (NDUFA8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4702 (NDUFA8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CHCH CX9C COX6B Cmc1 Motif Other DBs NCBI-GeneID:  4702 NCBI-ProteinID:  NP_055037 OMIM:  603359 HGNC:  7692 Ensembl:  ENSG00000119421 UniProt:  P51970 Structure PDB LinkDB All DBs Position 9:complement(122132466..122159779) Genome browser AA seq 172 aa AA seqDB search MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEG KLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRP DLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgccggggatagtggagctgcccactctagaggagctgaaagtagatgaggtgaaaatt agttctgctgtgcttaaagctgcggcccatcactatggagctcaatgtgataagcccaac aaggagtttatgctctgccgctgggaagagaaagatccgaggcggtgtttagaggaaggc aaactggtcaacaagtgtgctttggacttctttaggcagataaaacgtcactgtgcagag ccttttacagaatattggacttgcattgattatactggccagcagttatttcgtcactgt cgcaaacagcaggcaaagtttgacgagtgtgtgctggacaaactgggctgggtgcggcct gacctgggagaactgtcaaaggtcaccaaagtgaaaacagatcgacctttaccggagaat ccctatcactcaagaccaagaccggatcccagccctgagatcgagggagatctgcagcct gccacacatggcagccgcttttatttctggaccaagtaa

Homo sapiens (human): 4704 Help Entry 4704              CDS       T01001                                  Symbol NDUFA9, CC6, CI-39k, CI39k, COQ11, MC1DN26, NDUFS2L, SDR22E1 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A9   KO K03953   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4704 (NDUFA9)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4704 (NDUFA9)   09159 Environmental adaptation    04714 Thermogenesis     4704 (NDUFA9)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4704 (NDUFA9)   09164 Neurodegenerative disease    05010 Alzheimer disease     4704 (NDUFA9)    05012 Parkinson disease     4704 (NDUFA9)    05014 Amyotrophic lateral sclerosis     4704 (NDUFA9)    05016 Huntington disease     4704 (NDUFA9)    05020 Prion disease     4704 (NDUFA9)    05022 Pathways of neurodegeneration - multiple diseases     4704 (NDUFA9)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4704 (NDUFA9)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4704 (NDUFA9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Epimerase 3Beta_HSD NmrA NAD_binding_10 RmlD_sub_bind GDP_Man_Dehyd NAD_binding_4 adh_short Motif Other DBs NCBI-GeneID:  4704 NCBI-ProteinID:  NP_004993 OMIM:  603834 HGNC:  7693 Ensembl:  ENSG00000139180 UniProt:  Q16795 Structure PDB LinkDB All DBs Position 12:4649114..4694317 Genome browser AA seq 377 aa AA seqDB search MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFG ATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVV QHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRY LRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPV YVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRW VARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR WLSAEIEDVKPAKTVNI NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt atggcggctgccgcacaatcccgggttgtccgggtcctgtcaatgtcacgttctgccatt actgcaatagccacatctgtgtgtcacggcccaccctgtcgccagcttcatcatgccctc atgcctcatgggaaaggtggacgttcctcagtcagtgggattgtggccactgtgtttgga gcaacaggattcctggggcgatatgttgtcaaccaccttggacgcatggggtcacaggta atcataccctatcggtgtgataaatatgacatcatgcaccttcgtcccatgggtgacctg ggccagcttctgtttctggaatgggacgcgagagataaagattctatccgacgagtagta caacacagcaatgtggtcatcaatcttattggacgagactgggaaaccaaaaactttgat tttgaggatgtttttgtgaagattccccaagcaattgctcaactgtccaaggaagctgga gttgaaaaattcattcatgtttcacatctgaatgcgaatattaaaagctcttctagatat ttgagaaataaggctgttggagagaaagtagtgagagatgcatttccggaagccattatc gtaaagccgtcggacatctttggaagagaggatagattccttaattcttttgcaagtatg catcggtttggtcctataccccttggttccttgggctggaagacagttaaacaaccagta tatgtcgtagatgtatccaaaggaattgttaatgcagttaaggatcctgatgccaatggg aaatcctttgctttcgttggtcccagtcggtacctccttttccacctggtgaagtacatc tttgctgtggctcacagattgttcctcccattccccttgccgctttttgcctatcgatgg gtagcaagagtctttgaaataagcccatttgagccctggataacaagggataaagtggag cggatgcacatcacagacatgaaattgcctcacctgcctggcttagaagaccttggtatt caggcaacaccactggaactcaaggccattgaggtgctgcggcgtcatcgcacttaccgc tggctgtctgctgaaattgaggatgtgaagccggccaagaccgtcaacatttag

Homo sapiens (human): 4705 Help Entry 4705              CDS       T01001                                  Symbol NDUFA10, CI-42KD, CI-42k, MC1DN22 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A10   KO K03954   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4705 (NDUFA10)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4705 (NDUFA10)   09159 Environmental adaptation    04714 Thermogenesis     4705 (NDUFA10)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4705 (NDUFA10)   09164 Neurodegenerative disease    05010 Alzheimer disease     4705 (NDUFA10)    05012 Parkinson disease     4705 (NDUFA10)    05014 Amyotrophic lateral sclerosis     4705 (NDUFA10)    05016 Huntington disease     4705 (NDUFA10)    05020 Prion disease     4705 (NDUFA10)    05022 Pathways of neurodegeneration - multiple diseases     4705 (NDUFA10)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4705 (NDUFA10)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4705 (NDUFA10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  dNK AAA_28 AAA_17 Thymidylate_kin Cytidylate_kin TsaE Cytidylate_kin2 AAA_18 Motif Other DBs NCBI-GeneID:  4705 NCBI-ProteinID:  NP_004535 OMIM:  603835 HGNC:  7684 Ensembl:  ENSG00000130414 UniProt:  O95299 Structure PDB LinkDB All DBs Position 2:complement(239892442..240025342) Genome browser AA seq 355 aa AA seqDB search MALRLLKLAATSASARVVAAGAQRVRGIHSSVQCKLRYGMWHFLLGDKASKRLTERSRVI TVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDD PRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLEAMYNQGFIR KQCVDHYNEVKSVTICDYLPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENA YKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQDNRTLYHLRLLVQD KFEVLNYTSIPIFLPEVTIGAHQTDRVLHQFRELPGRKYSPGYNTEVGDKWIWLK NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt atggccttgcggctcctgaagctggcagcgacgtccgcgtccgcccgggtcgtggcggcg ggcgcccagcgcgtgagaggaattcatagcagtgtgcagtgcaaactgcgctatggaatg tggcatttcctacttggggataaagcaagcaaaagactgacagaacgcagcagagtgata actgtagatggcaatatatgtactggaaaaggcaaacttgcaaaagaaatagcagagaaa ctaggcttcaagcactttcctgaagcggggattcattatccagacagtaccacaggagat gggaagcccctcgccaccgactataatggcaactgtagtttggagaaattttacgatgat ccgagaagcaatgatggcaacagttaccgcctgcagtcctggttgtacagcagtcgcctg ctgcagtactcagatgccttggagcacttgctgaccacaggacaaggtgttgtgttggag cgctccatcttcagtgactttgtgttcctggaggcgatgtacaaccagggattcatccga aagcagtgtgtggaccactacaacgaggtgaagagcgtcaccatctgcgattacctgccc ccccacctggtgatttacatcgatgtgcccgttccagaggtccagaggcggattcagaag aaaggagatccacatgaaatgaagatcacctctgcctatctacaggacattgagaatgcc tataagaaaacctttctccctgagatgagtgaaaaatgtgaggttttacaatattctgca agggaagctcaagattcaaaaaaggtggtagaggacattgaatacctgaagttcgataaa gggccgtggctcaagcaggacaatcgcactttataccacctgcgattactggttcaggat aagtttgaggtgctgaattacacaagcattcctatctttctcccggaagtcaccattgga gctcatcagactgaccgtgtcttacatcagttcagagagctgccgggccgcaagtacagc cctgggtacaacaccgaggtgggagacaagtggatctggctgaagtga

Homo sapiens (human): 126328 Help Entry 126328            CDS       T01001                                  Symbol NDUFA11, B14.7, CI-B14.7, MC1DN14 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A11   KO K03956   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     126328 (NDUFA11)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     126328 (NDUFA11)   09159 Environmental adaptation    04714 Thermogenesis     126328 (NDUFA11)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     126328 (NDUFA11)   09164 Neurodegenerative disease    05010 Alzheimer disease     126328 (NDUFA11)    05012 Parkinson disease     126328 (NDUFA11)    05014 Amyotrophic lateral sclerosis     126328 (NDUFA11)    05016 Huntington disease     126328 (NDUFA11)    05020 Prion disease     126328 (NDUFA11)    05022 Pathways of neurodegeneration - multiple diseases     126328 (NDUFA11)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     126328 (NDUFA11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     126328 (NDUFA11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tim17 Motif Other DBs NCBI-GeneID:  126328 NCBI-ProteinID:  NP_783313 OMIM:  612638 HGNC:  20371 Ensembl:  ENSG00000174886 UniProt:  Q86Y39 Structure PDB LinkDB All DBs Position 19:complement(5891229..5903790) Genome browser AA seq 141 aa AA seqDB search MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT FTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGI AASLVKMGRLEGWEVFAKPKV NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcgccgaaggtttttcgtcagtactgggatatccccgatggcaccgattgccaccgc aaagcctacagcaccaccagtattgccagcgtcgctggcctgaccgccgctgcctacaga gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg ttcactgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtc cgcgagaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgact ctgggagcacgcacgcacaactacgggattggcgccgccgcctgcgtgtactttggcata gcggcctccctggtcaagatgggccggctggagggctgggaggtgtttgcaaaacccaag gtgtga

Homo sapiens (human): 55967 Help Entry 55967             CDS       T01001                                  Symbol NDUFA12, B17.2, DAP13, MC1DN23 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A12   KO K11352   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     55967 (NDUFA12)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     55967 (NDUFA12)   09159 Environmental adaptation    04714 Thermogenesis     55967 (NDUFA12)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     55967 (NDUFA12)   09164 Neurodegenerative disease    05010 Alzheimer disease     55967 (NDUFA12)    05012 Parkinson disease     55967 (NDUFA12)    05014 Amyotrophic lateral sclerosis     55967 (NDUFA12)    05016 Huntington disease     55967 (NDUFA12)    05020 Prion disease     55967 (NDUFA12)    05022 Pathways of neurodegeneration - multiple diseases     55967 (NDUFA12)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     55967 (NDUFA12)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     55967 (NDUFA12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFA12 Motif Other DBs NCBI-GeneID:  55967 NCBI-ProteinID:  NP_061326 OMIM:  614530 HGNC:  23987 Ensembl:  ENSG00000184752 UniProt:  Q9UI09 Structure PDB LinkDB All DBs Position 12:complement(94971333..95003697) Genome browser AA seq 145 aa AA seqDB search MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHR WVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGT PEQYVPYSTTRKKIQEWIPPSTPYK NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggagttagtgcaggtcctgaaacgcgggctgcagcagatcaccggccacggcggtctc cgaggctatctacgggtttttttcaggacaaatgatgcgaaggttggtacattagtgggg gaagacaaatatggaaacaaatactatgaagacaacaagcaattttttggccgtcaccga tgggttgtatatactactgaaatgaatggcaaaaacacattctgggatgtggatggaagc atggtgcctcctgaatggcatcgttggcttcacagtatgactgatgatcctccaacaaca aaaccacttactgctcgtaaattcatttggacgaaccataaattcaacgtgactggcacc ccagaacaatatgtaccttattctaccactagaaagaagattcaggagtggatcccacct tcaacaccttacaagtaa

Homo sapiens (human): 51079 Help Entry 51079             CDS       T01001                                  Symbol NDUFA13, B16.6, CDA016, CGI-39, GRIM-19, GRIM19, MC1DN28 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit A13   KO K11353   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00146   NADH dehydrogenase (ubiquinone) 1 alpha subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     51079 (NDUFA13)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     51079 (NDUFA13)   09159 Environmental adaptation    04714 Thermogenesis     51079 (NDUFA13)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     51079 (NDUFA13)   09164 Neurodegenerative disease    05010 Alzheimer disease     51079 (NDUFA13)    05012 Parkinson disease     51079 (NDUFA13)    05014 Amyotrophic lateral sclerosis     51079 (NDUFA13)    05016 Huntington disease     51079 (NDUFA13)    05020 Prion disease     51079 (NDUFA13)    05022 Pathways of neurodegeneration - multiple diseases     51079 (NDUFA13)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     51079 (NDUFA13)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     51079 (NDUFA13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GRIM-19 COX14 CSTF_C Motif Other DBs NCBI-GeneID:  51079 NCBI-ProteinID:  NP_057049 OMIM:  609435 HGNC:  17194 Ensembl:  ENSG00000186010 UniProt:  Q9P0J0 Structure PDB LinkDB All DBs Position 19:19516225..19528198 Genome browser AA seq 144 aa AA seqDB search MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRL QIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPL IGELYGLRTTEEALHASHGFMWYT NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggcggcgtcaaaggtgaagcaggacatgcctccgccggggggctatgggcccatcgac tacaaacggaacttgccgcgtcgaggactgtcgggctacagcatgctggccatagggatt ggaaccctgatctacgggcactggagcataatgaagtggaaccgtgagcgcaggcgccta caaatcgaggacttcgaggctcgcatcgcgctgttgccactgttacaggcagaaaccgac cggaggaccttgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac gtgcccgactggaaggtgggggagtctgtgttccacacaacccgctgggtgccccccttg atcggggagctgtacgggctgcgcaccacagaggaggctctccatgccagccacggcttc atgtggtacacgtag

Homo sapiens (human): 4709 Help Entry 4709              CDS       T01001                                  Symbol NDUFB3, B12, CI-B12, MC1DN25 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B3   KO K03959   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4709 (NDUFB3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4709 (NDUFB3)   09159 Environmental adaptation    04714 Thermogenesis     4709 (NDUFB3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4709 (NDUFB3)   09164 Neurodegenerative disease    05010 Alzheimer disease     4709 (NDUFB3)    05012 Parkinson disease     4709 (NDUFB3)    05014 Amyotrophic lateral sclerosis     4709 (NDUFB3)    05016 Huntington disease     4709 (NDUFB3)    05020 Prion disease     4709 (NDUFB3)    05022 Pathways of neurodegeneration - multiple diseases     4709 (NDUFB3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4709 (NDUFB3)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4709 (NDUFB3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B12 Motif Other DBs NCBI-GeneID:  4709 NCBI-ProteinID:  NP_001244031 OMIM:  603839 HGNC:  7698 Ensembl:  ENSG00000119013 UniProt:  O43676 Structure PDB LinkDB All DBs Position 2:201072001..201085750 Genome browser AA seq 98 aa AA seqDB search MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKS VSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcccatgaacatggacatgagcatggacatcataaaatggaacttccagattataga caatggaagatagaagggacaccattagaaactatccagaagaagctggctgcaaaaggg ctaagggatccatggggccgcaatgaagcttggagatacatgggtggctttgcaaagagt gtttccttttctgatgtattctttaaaggattcaaatggggatttgctgcatttgtggta gctgtaggagctgaatattacctggagtccctgaataaagataagaagcatcactga

Homo sapiens (human): 4714 Help Entry 4714              CDS       T01001                                  Symbol NDUFB8, ASHI, CI-ASHI, MC1DN32 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B8   KO K03964   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4714 (NDUFB8)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4714 (NDUFB8)   09159 Environmental adaptation    04714 Thermogenesis     4714 (NDUFB8)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4714 (NDUFB8)   09164 Neurodegenerative disease    05010 Alzheimer disease     4714 (NDUFB8)    05012 Parkinson disease     4714 (NDUFB8)    05014 Amyotrophic lateral sclerosis     4714 (NDUFB8)    05016 Huntington disease     4714 (NDUFB8)    05020 Prion disease     4714 (NDUFB8)    05022 Pathways of neurodegeneration - multiple diseases     4714 (NDUFB8)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4714 (NDUFB8)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4714 (NDUFB8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B8 Motif Other DBs NCBI-GeneID:  4714 NCBI-ProteinID:  NP_004995 OMIM:  602140 HGNC:  7703 Ensembl:  ENSG00000166136 UniProt:  O95169 Structure PDB LinkDB All DBs Position 10:complement(100523729..100529923) Genome browser AA seq 186 aa AA seqDB search MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVE DYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTS PTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPER VVHYEI NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggcggtggccagggccggggtcttgggagtccagtggctgcaaagggcatcccggaac gtgatgccgctgggcgcacggacagcctcccacatgaccaaggacatgttcccggggccc tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa gactacgaaccttacccggatgatggcatggggtatggcgactacccgaagctccctgac cgctcacagcatgagagagatccatggtatagctgggaccagccgggcctgaggttgaac tggggtgaaccgatgcactggcacctagacatgtacaacaggaaccgtgtggatacatcc cccacacctgtttcttggcatgtcatgtgtatgcagctcttcggtttcctggctttcatg atattcatgtgctgggtgggggacgtgtaccctgtctaccagcctgtgggaccaaagcag tatccttacaataatctgtacctggaacgaggcggtgatccctccaaagaaccagagcgg gtggttcactatgagatctga

Homo sapiens (human): 4715 Help Entry 4715              CDS       T01001                                  Symbol NDUFB9, B22, CI-B22, LYRM3, MC1DN24, UQOR22 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B9   KO K03965   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4715 (NDUFB9)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4715 (NDUFB9)   09159 Environmental adaptation    04714 Thermogenesis     4715 (NDUFB9)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4715 (NDUFB9)   09164 Neurodegenerative disease    05010 Alzheimer disease     4715 (NDUFB9)    05012 Parkinson disease     4715 (NDUFB9)    05014 Amyotrophic lateral sclerosis     4715 (NDUFB9)    05016 Huntington disease     4715 (NDUFB9)    05020 Prion disease     4715 (NDUFB9)    05022 Pathways of neurodegeneration - multiple diseases     4715 (NDUFB9)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4715 (NDUFB9)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4715 (NDUFB9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Complex1_LYR Complex1_LYR_2 ImpA_N Motif Other DBs NCBI-GeneID:  4715 NCBI-ProteinID:  NP_004996 OMIM:  601445 HGNC:  7704 Ensembl:  ENSG00000147684 UniProt:  Q9Y6M9 Structure PDB LinkDB All DBs Position 8:124539123..124549979 Genome browser AA seq 179 aa AA seqDB search MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKA TQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFA KREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggcgttcttggcgtcgggaccctacctgacccatcagcaaaaggtgttgcggctttat aagcgggcgctacgccacctcgagtcgtggtgcgtccagagagacaaataccgatacttt gcttgtttgatgagagcccggtttgaagaacataagaatgaaaaggatatggcgaaggcc acccagctgctgaaggaggccgaggaagaattctggtaccgtcagcatccacagccatac atcttccctgactctcctgggggcacctcctatgagagatacgattgctacaaggtccca gaatggtgcttagatgactggcatccttctgagaaggcaatgtatcctgattactttgcc aagagagaacagtggaagaaactgcggagggaaagctgggaacgagaggttaagcagctg caggaggaaacgccacctggtggtcctttaactgaagctttgccccctgcccgaaaggaa ggtgatttgcccccactgtggtggtatattgtgaccagaccccgggagcggcccatgtag

Homo sapiens (human): 4716 Help Entry 4716              CDS       T01001                                  Symbol NDUFB10, MC1DN35, PDSW Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B10   KO K03966   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4716 (NDUFB10)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4716 (NDUFB10)   09159 Environmental adaptation    04714 Thermogenesis     4716 (NDUFB10)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4716 (NDUFB10)   09164 Neurodegenerative disease    05010 Alzheimer disease     4716 (NDUFB10)    05012 Parkinson disease     4716 (NDUFB10)    05014 Amyotrophic lateral sclerosis     4716 (NDUFB10)    05016 Huntington disease     4716 (NDUFB10)    05020 Prion disease     4716 (NDUFB10)    05022 Pathways of neurodegeneration - multiple diseases     4716 (NDUFB10)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4716 (NDUFB10)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4716 (NDUFB10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFB10 Motif Other DBs NCBI-GeneID:  4716 NCBI-ProteinID:  NP_004539 OMIM:  603843 HGNC:  7696 Ensembl:  ENSG00000140990 UniProt:  O96000 A8K761 Structure PDB LinkDB All DBs Position 16:1959538..1961975 Genome browser AA seq 172 aa AA seqDB search MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgccggacagctgggacaaggatgtgtaccctgagcccccgcgccgcacgccggtgcag cccaatcccatcgtctacatgatgaaagcgttcgacctcatcgtggaccgacccgtgacc ctcgtgagagaatttatagagcggcagcacgcaaagaacaggtattactactaccaccgg cagtaccgccgcgtgccagacatcactgagtgcaaggaggaggacatcatgtgcatgtat gaagccgaaatgcagtggaagagggactacaaagtcgaccaagaaattatcaacattatg caggatcggctcaaagcctgtcagcagagggaaggacagaactaccagcagaactgtatc aaggaagtggagcagttcacccaggtggccaaggcctaccaggaccgctatcaggacctg ggggcctacagttctgccaggaagtgcctggccaaacagaggcagaggatgctgcaagag agaaaagctgcaaaagaggccgccgctgccacctcctga

Homo sapiens (human): 54539 Help Entry 54539             CDS       T01001                                  Symbol NDUFB11, CI-ESSS, ESSS, MC1DN30, NP17.3, Np15, P17.3 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B11   KO K11351   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01904   Microphthalmia with linear skin defects syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     54539 (NDUFB11)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     54539 (NDUFB11)   09159 Environmental adaptation    04714 Thermogenesis     54539 (NDUFB11)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     54539 (NDUFB11)   09164 Neurodegenerative disease    05010 Alzheimer disease     54539 (NDUFB11)    05012 Parkinson disease     54539 (NDUFB11)    05014 Amyotrophic lateral sclerosis     54539 (NDUFB11)    05016 Huntington disease     54539 (NDUFB11)    05020 Prion disease     54539 (NDUFB11)    05022 Pathways of neurodegeneration - multiple diseases     54539 (NDUFB11)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     54539 (NDUFB11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     54539 (NDUFB11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ESSS Motif Other DBs NCBI-GeneID:  54539 NCBI-ProteinID:  NP_001129470 OMIM:  300403 HGNC:  20372 Ensembl:  ENSG00000147123 UniProt:  Q9NX14 Structure PDB LinkDB All DBs Position X:complement(47142216..47145491) Genome browser AA seq 153 aa AA seqDB search MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPE PEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRR EAERLVKYREANGLPIMESNCFDPSKIQLPEDE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcggctgggctgtttggtttgagcgctcgccgtcttttggcggcagcggcgacgcga gggctcccggccgcccgcgtccgctgggaatctagcttctccaggactgtggtcgccccg tccgctgtggcgggaaagcggcccccagaaccgaccacaccgtggcaagaggacccagaa cccgaggacgaaaacttgtatgagaagaacccagactcccatggttatgacaaggacccc gttttggacgtctggaacatgcgacttgtcttcttctttggcgtctccatcatcctggtc cttggcagcacctttgtggcctatctgcctgactacaggatgaaagagtggtcccgccgc gaagctgagaggcttgtgaaataccgagaggccaatggccttcccatcatggaatccaac tgcttcgaccccagcaagatccagctgccagaggatgagtga

Homo sapiens (human): 4718 Help Entry 4718              CDS       T01001                                  Symbol NDUFC2, B14.5b, CI-B14.5b, HLC-1, MC1DN36, NADHDH2 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit C2   KO K03968   NADH dehydrogenase (ubiquinone) 1 subunit C2 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4718 (NDUFC2)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4718 (NDUFC2)   09159 Environmental adaptation    04714 Thermogenesis     4718 (NDUFC2)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4718 (NDUFC2)   09164 Neurodegenerative disease    05010 Alzheimer disease     4718 (NDUFC2)    05012 Parkinson disease     4718 (NDUFC2)    05014 Amyotrophic lateral sclerosis     4718 (NDUFC2)    05016 Huntington disease     4718 (NDUFC2)    05020 Prion disease     4718 (NDUFC2)    05022 Pathways of neurodegeneration - multiple diseases     4718 (NDUFC2)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4718 (NDUFC2)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4718 (NDUFC2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_C2 HL_N-beta Motif Other DBs NCBI-GeneID:  4718 NCBI-ProteinID:  NP_004540 OMIM:  603845 HGNC:  7706 Ensembl:  ENSG00000151366 UniProt:  O95298 Structure PDB LinkDB All DBs Position 11:complement(78068297..78079862) Genome browser AA seq 119 aa AA seqDB search MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQ LLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgatcgcacggcggaacccagaacccttacggtttctgccggatgaggcccggagcctg cccccgcccaagctgaccgacccgcggctcctctacatcggcttcttgggctactgctcc ggcctgattgataacctaatccggcggaggccgatcgcgacggctggtttgcatcgccag cttctatatattacggcctttttttttgctggatattatcttgtaaaacgtgaagactac ctgtatgctgtgagggaccgtgaaatgtttggatatatgaaattacatccagaggatttt cctgaagaagataagaaaacatatggtgaaatttttgaaaaattccatccaatacgttga

Homo sapiens (human): 51103 Help Entry 51103             CDS       T01001                                  Symbol NDUFAF1, CGI-65, CGI65, CIA30, MC1DN11 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 1   KO K18159   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     51103 (NDUFAF1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     51103 (NDUFAF1) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     51103 (NDUFAF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CIA30 CBM_11 Motif Other DBs NCBI-GeneID:  51103 NCBI-ProteinID:  NP_057097 OMIM:  606934 HGNC:  18828 Ensembl:  ENSG00000137806 UniProt:  Q9Y375 LinkDB All DBs Position 15:complement(41387353..41403026) Genome browser AA seq 327 aa AA seqDB search MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQ GDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQ AKVVWQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRS GYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYF MFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDF IGVFTDPAHTEEFAYENSPELNPRLFK NT seq 984 nt NT seq  +upstreamnt  +downstreamnt atggctttggttcacaaattgctgcgtggtacttattttctcagaaaattctctaagcca acttctgccttgtatccatttttgggtattcgctttgcagagtattccagtagtcttcag aaaccagtggcttctcctggcaaagcctcctcacagaggaagactgaaggggatttgcaa ggagatcaccagaaagaagttgctttggatataacttcttctgaggagaagcctgatgtt agtttcgataaagcaattagagatgaagcaatataccattttaggcttttgaaggatgaa attgtggatcattggagaggaccggaaggccaccctctgcatgaggtcttgctggaacaa gccaaggttgtctggcaattccgggggaaagaagatttggataagtggacagtgacttct gataagacgattggaggcagaagtgaagtgtttttgaaaatgggcaagaataaccaaagt gcactgctatatggaactctgagctctgaggcgcctcaggacggggagtctacccgaagt gggtactgtgcaatgatatccaggattccaaggggtgcttttgagaggaagatgtcttac gattggtcccagttcaatactctgtatctccgtgtacgtggggatggtcggccttggatg gtgaatatcaaggaggacacagatttcttccagaggacgaatcagatgtatagttacttc atgttcacccgcgggggaccctactggcaggaggtcaagattcctttttccaaatttttc ttctctaatcgaggaagaatccgggatgttcagcatgagcttccgcttgataagatctct tctataggattcaccttggctgataaagtggatggtccattcttcctggagatagatttt attggcgtgtttactgatccagctcatacagaagaatttgcctatgaaaattctccagag cttaacccaaggctttttaaataa

Homo sapiens (human): 91942 Help Entry 91942             CDS       T01001                                  Symbol NDUFAF2, B17.2L, MC1DN10, MMTN, NDUFA12L, mimitin Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 2   KO K18160   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     91942 (NDUFAF2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     91942 (NDUFAF2) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     91942 (NDUFAF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUFA12 Motif Other DBs NCBI-GeneID:  91942 NCBI-ProteinID:  NP_777549 OMIM:  609653 HGNC:  28086 Ensembl:  ENSG00000164182 UniProt:  Q8N183 A0A0S2Z5U1 LinkDB All DBs Position 5:60945205..61153026 Genome browser AA seq 169 aa AA seqDB search MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEV DYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEEL LPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgggttggtctcaggatttgttccgcgccttgtggagatcgctgtcaagggaagtgaag gagcacgtgggcacggaccaattcgggaacaaatactactacatcccgcagtacaagaac tggagaggacaaactattcgagagaaaagaattgtagaagcagcaaataaaaaagaagta gactatgaagcaggggatattccaacagaatgggaagcttggattagaagaacaagaaag actccacctactatggaggaaatactaaagaatgaaaaacacagagaagaaatcaaaata aaaagccaagatttttatgaaaaagaaaaactccttagtaaagagaccagtgaggaactc ctgcctccaccagttcaaactcaaattaaaggccatgcctctgctccatactttggaaag gaagaaccctcagtggctcccagcagcactggtaaaacctttcagccaggatcctggatg ccacgagatggcaagagccacaatcaatga

Homo sapiens (human): 25915 Help Entry 25915             CDS       T01001                                  Symbol NDUFAF3, 2P1, C3orf60, E3-3, MC1DN18 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 3   KO K09008   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     25915 (NDUFAF3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     25915 (NDUFAF3) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     25915 (NDUFAF3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF498 NAD_binding_7 Motif Other DBs NCBI-GeneID:  25915 NCBI-ProteinID:  NP_951032 OMIM:  612911 HGNC:  29918 Ensembl:  ENSG00000178057 UniProt:  Q9BU61 Q9Y3Z0 LinkDB All DBs Position 3:49020452..49023495 Genome browser AA seq 184 aa AA seqDB search MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYI DSYNSRGFMINGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTG DRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLG QAAQ NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atggccaccgctctcgcgctacgtagcttgtaccgagcgcgaccctcgctgcgctgtccg cccgttgagcttccctgggccccgcggcgagggcatcggctctcgccggcggatgacgag ctgtatcagcggacgcgcatctctctgctgcaacgcgaggccgctcaggcaatgtacatc gacagctacaacagccgcggcttcatgataaacggaaaccgcgtgctcggcccctgcgct ctgctcccgcactcggtggtgcagtggaacgtgggatcccaccaggacatcaccgaagac agcttttccctcttctggttgctggagccccggatagagatcgtggtggtggggactgga gaccggaccgagaggctgcagtcccaggtgcttcaagccatgaggcagcggggcattgct gtggaagtgcaggacacgcccaatgcctgtgccaccttcaacttcctgtgtcatgaaggc cgagtaactggagctgctctcatccctccaccaggagggacttcacttacatctttgggc caagctgctcaatga

Homo sapiens (human): 29078 Help Entry 29078             CDS       T01001                                  Symbol NDUFAF4, C6orf66, HRPAP20, HSPC125, MC1DN15, My013, bA22L21.1 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 4   KO K18161   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     29078 (NDUFAF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     29078 (NDUFAF4) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     29078 (NDUFAF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  UPF0240 TibC_1st Motif Other DBs NCBI-GeneID:  29078 NCBI-ProteinID:  NP_054884 OMIM:  611776 HGNC:  21034 Ensembl:  ENSG00000123545 UniProt:  Q9P032 LinkDB All DBs Position 6:complement(96889315..96897891) Genome browser AA seq 175 aa AA seqDB search MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEK LLSFLKDVYVDSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEAL TLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgggagcactagtgattcgcggtatcaggaatttcaacctagagaaccgagcggaacgg gaaatcagcaagatgaagccctctgtcgctcccagacacccctctaccaacagcctcctg cgagagcagattagtctctatccagaagttaaaggagagattgctcgtaaagatgaaaag ctgctgtcgtttctaaaagatgtgtatgttgattccaaagatcctgtgtcttccttgcag gtaaaagctgctgaaacatgtcaagagccgaaggaattcagattgccgaaagaccatcat tttgatatgataaatattaagagcattcccaaaggcaaaatttccattgtagaagcattg acacttctcaataatcataagcttttcccagaaacctggactgctgagaaaataatgcag gaataccagttagaacagaaagatgtgaattctcttcttaaatattttgttacttttgaa gtcgaaatcttccctcctgaagacaagaaagcaatacgatcaaaatga

Homo sapiens (human): 79133 Help Entry 79133             CDS       T01001                                  Symbol NDUFAF5, C20orf7, MC1DN16, bA526K24.2, dJ842G6.1 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 5   KO K18162   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 [EC:2.1.1.-] Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     79133 (NDUFAF5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     79133 (NDUFAF5) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     79133 (NDUFAF5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Methyltransf_11 Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_31 Ubie_methyltran Methyltransf_29 mRNA_G-N7_MeTrfase MetW FtsJ MTS Methyltransf_7 Motif Other DBs NCBI-GeneID:  79133 NCBI-ProteinID:  NP_077025 OMIM:  612360 HGNC:  15899 Ensembl:  ENSG00000101247 UniProt:  Q5TEU4 LinkDB All DBs Position 20:13785028..13821580 Genome browser AA seq 345 aa AA seqDB search MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAA RQPEPTKFDYLKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADI AENALKNSSETEIPTVSVLADEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKP DGVFIGAMFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTLTVD TDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRNEDGSVPAT YQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt atgctgcggccggcagggctctggcgcttatgtcggcgaccttgggcggcgagggtccca gcggagaatcttggccgtagggaagtcacctctggtgtctctccccgcggtagcacctcg cccagaaccctgaatattttcgaccgggatttgaaaaggaaacagaagaactgggcagcc cggcagcccgagccgaccaaatttgactacctgaaggaggaggttggaagtcggatcgca gaccgtgtatatgacatacccagaaatttcccccttgctttggatcttggttgtggaaga ggttacattgcacaatatttgaataaggaaactattggaaagtttttccaagctgacatt gcagaaaatgctttgaaaaattcctcagaaacagaaatacctactgtcagcgttttagct gatgaagaattccttcccttcaaagaaaatacatttgacctggtggttagcagtttaagt ttgcattgggtgaatgaccttcctagagcacttgagcagattcattatattttaaaacca gatggagtgtttatcggtgcaatgtttggaggcgacacactctatgaacttcggtgttcc ttacagttagcggaaacggaaagggaaggaggattttctccacacatttctcctttcact gctgtcaatgacctgggacatctgcttgggagagctggctttaatactctgactgtggac actgatgaaattcaagttaactatcctggaatgtttgaattgatggaagatttacaaggt atgggtgagagtaactgtgcttggaatagaaaagccctgctgcatcgagacacaatgctg gcagctgcggcagtgtacagagaaatgtacagaaatgaagatggttcagtacctgctaca taccagatctattacatgataggatggaaatatcatgagtcacaggcaagaccagctgaa agaggttccgcaactgtgtcatttggagagctaggaaaaataaacaaccttatgccaccg gggaaaaaatcacaataa

Homo sapiens (human): 137682 Help Entry 137682            CDS       T01001                                  Symbol NDUFAF6, C8orf38, FRTS5, MC1DN17 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 6   KO K18163   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 6 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency H01198   Fanconi renotubular syndrome H01354   Leigh syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     137682 (NDUFAF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     137682 (NDUFAF6) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     137682 (NDUFAF6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SQS_PSY Motif Other DBs NCBI-GeneID:  137682 NCBI-ProteinID:  NP_689629 OMIM:  612392 HGNC:  28625 Ensembl:  ENSG00000156170 UniProt:  Q330K2 LinkDB All DBs Position 8:94895799..95118496 Genome browser AA seq 333 aa AA seqDB search MAASAHGSVWGPLRLGIPGLCCRRPPLGLYARMRRLPGPEVSGRSVAAASGPGAWGTDHY CLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKT VEDIYCDNPPHQPVAIELWKAVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYAEN TQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRATPYHGSRRKVFLPMDICMLHG VSQEDFLRRNQDKNVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKK IQRVDFDIFHPSLQQKNTLLPLYLYIQSWRKTY NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt atggcggcctccgcgcacggctctgtctgggggccgttgcggcttggcatccccggcctg tgctgccgccggccgcctctgggtctgtacgcgcgcatgcggcggctgcccgggccggag gtgtctgggcggagcgtggctgcggccagcggaccgggcgcctggggcactgaccactac tgcctggagctgctgcggaaacgggattatgaaggttatttatgctccctgctgctccct gcagaatcccgaagctctgtttttgcactgagggcctttaatgtggaactggctcaggtt aaagactcagtctctgagaaaacaattggactgatgcgaatgcagttttggaaaaaaact gtggaagatatatactgtgacaatccaccacatcagcctgtggccattgaactatggaag gctgttaaaagacataatctgactaaaagatggcttatgaaaatcgtcgatgaaagagaa aaaaatctggatgacaaagcatatcgtaatatcaaggaactggaaaattatgctgaaaac acacagagctctcttctttacttaacactagaaatattgggtataaaggatcttcatgca gatcatgctgcaagtcatattggaaaagcacaaggcattgtcacttgcttgagagcaaca ccatatcatgggagcagaagaaaggtgttccttcccatggatatttgtatgctgcatggt gtttcacaagaggactttctacggaggaaccaagataaaaatgtgagagatgtaatatat gacattgccagtcaagcacacttgcacctaaagcatgctaggtcctttcacaaaactgtt cctgtgaaagcatttcctgcttttcttcagacggtttctctagaggactttctaaagaaa attcagcgagtggattttgatatattccacccatctttacagcagaagaatacattactt ccattatatttgtatattcagtcatggagaaaaacatattaa

Homo sapiens (human): 284184 Help Entry 284184            CDS       T01001                                  Symbol NDUFAF8, C17orf89, MC1DN34 Name (RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 8   KO K24726   NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8 Organism hsa  Homo sapiens (human) Pathway hsa04714   Thermogenesis Network nt06529  Thermogenesis   Element N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     284184 (NDUFAF8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     284184 (NDUFAF8) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial respiratory chain complex assembly factors    Complex-I assembly factors     284184 (NDUFAF8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CX9C Motif Other DBs NCBI-GeneID:  284184 NCBI-ProteinID:  NP_001079990 OMIM:  618461 HGNC:  33551 Ensembl:  ENSG00000224877 UniProt:  A1L188 LinkDB All DBs Position 17:81239311..81241310 Genome browser AA seq 74 aa AA seqDB search MSANGAVWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFEALRS CFAAAAKKTLEGGC NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtcggctaacggagcggtgtggggccgcgtgcgaagccgcctccgcgccttccccgag cggctggccgcctgcggggccgaggccgcggcgtacggcaggtgcgtgcaggcctccacg gccccgggcggccgcctgagtaaggacttctgcgcgcgggagttcgaggccctgcggagc tgcttcgccgctgcggccaagaagacgctggagggaggctgttag

Homo sapiens (human): 4713 Help Entry 4713              CDS       T01001                                  Symbol NDUFB7, B18, CI-B18, MC1DN39 Name (RefSeq) NADH:ubiquinone oxidoreductase subunit B7   KO K03963   NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7 Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04714   Thermogenesis hsa04723   Retrograde endocannabinoid signaling hsa04932   Non-alcoholic fatty liver disease hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05014   Amyotrophic lateral sclerosis hsa05016   Huntington disease hsa05020   Prion disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05208   Chemical carcinogenesis - reactive oxygen species hsa05415   Diabetic cardiomyopathy Module hsa_M00147   NADH dehydrogenase (ubiquinone) 1 beta subcomplex Network nt06460  Alzheimer disease nt06463  Parkinson disease nt06464  Amyotrophic lateral sclerosis nt06466  Pathways of neurodegeneration nt06529  Thermogenesis   Element N00995   Electron transfer in Complex I N00997   Mutation-caused aberrant Abeta to electron transfer in Complex I N01042   Mutation-caused aberrant SNCA to electron transfer in Complex I N01043   Mutation-inactivated PINK1 to electron transfer in Complex I N01044   MPP+ to electron transfer in Complex I N01045   Rotenone to electron transfer in Complex I N01136   Mutation-caused aberrant TDP43 to electron transfer in Complex I N01691   mitochondrial complex - UCP1 in Thermogenesis Disease H00473   Mitochondrial complex I deficiency Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4713 (NDUFB7)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4713 (NDUFB7)   09159 Environmental adaptation    04714 Thermogenesis     4713 (NDUFB7)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4713 (NDUFB7)   09164 Neurodegenerative disease    05010 Alzheimer disease     4713 (NDUFB7)    05012 Parkinson disease     4713 (NDUFB7)    05014 Amyotrophic lateral sclerosis     4713 (NDUFB7)    05016 Huntington disease     4713 (NDUFB7)    05020 Prion disease     4713 (NDUFB7)    05022 Pathways of neurodegeneration - multiple diseases     4713 (NDUFB7)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4713 (NDUFB7)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     4713 (NDUFB7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDUF_B7 OrfB_IS605 Cmc1 Motif Other DBs NCBI-GeneID:  4713 NCBI-ProteinID:  NP_004137 OMIM:  603842 HGNC:  7702 Ensembl:  ENSG00000099795 UniProt:  P17568 Structure PDB LinkDB All DBs Position 19:complement(14566078..14572066) Genome browser AA seq 137 aa AA seqDB search MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCA HHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAA ELAKGQGPGEVDPKVAL NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggcccacctggtccggcgctacctgggcgatgcctcggtggagcccgaccccctg cagatgccaaccttcccgccagactacggcttccccgaacgcaaggagcgcgagatggtg gccacacagcaggagatgatggacgcgcagctgaggctccagctgcgggactactgcgcc caccacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc aagcaggagcggcacgactgggactactgcgagcaccgcgactatgtgatgcgcatgaag gagtttgagcgggagcggaggctgctccagcggaagaagcggcgggagaagaaggcggca gagttggccaaaggccagggacccggggaagtggaccccaaggtggccctgtag

DBGET integrated database retrieval system