Homo sapiens (human): 55651 Help Entry 55651             CDS       T01001                                  Symbol NHP2, DKCB2, NHP2P, NOLA2 Name (RefSeq) NHP2 ribonucleoprotein   KO K11129   H/ACA ribonucleoprotein complex subunit 2 Organism hsa  Homo sapiens (human) Pathway hsa03008   Ribosome biogenesis in eukaryotes Network nt06510  Telomere length regulation   Element N01476   Assembly and trafficking of telomerase N01477   Telomere elongation Disease H00507   Dyskeratosis congenita Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     55651 (NHP2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:hsa03009]     55651 (NHP2)    03032 DNA replication proteins [BR:hsa03032]     55651 (NHP2) Ribosome biogenesis [BR:hsa03009]  Eukaryotic type   Sno RNPs    Box H/ACA snoRNPs     55651 (NHP2) DNA replication proteins [BR:hsa03032]  Eukaryotic type   DNA Replication Termination Factors    Telomerase complex (animals)     Dyskerin complex      55651 (NHP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L7Ae Ribosomal_L31e Phage_RpbA Motif Other DBs NCBI-GeneID:  55651 NCBI-ProteinID:  NP_060308 OMIM:  606470 HGNC:  14377 Ensembl:  ENSG00000145912 UniProt:  Q9NX24 Structure PDB LinkDB All DBs Position 5:complement(178149463..178153885) Genome browser AA seq 153 aa AA seqDB search MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQI RRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGS KRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgaccaaaataaaggcagatcccgacgggcccgaggctcaggcggaggcgtgttccggg gagcgcacctaccaggagctgctggtcaaccagaaccccatcgcgcagcccctggcttct cgccgcctcacgcggaagctctacaaatgcatcaagaaagcggtgaagcagaagcagatt cggcgcggggtgaaagaggttcagaaatttgtcaacaaaggagaaaaagggatcatggtt ttggcaggagacacactgcccattgaggtatactgccatctcccagtcatgtgtgaggac cgaaatttgccctatgtctatatcccctctaagacggacctgggtgcagccgcaggctcc aagcgccccacctgtgtgataatggtcaagccccatgaggagtaccaggaggcttacgat gagtgcctggaggaggtgcagtccctgcccctacccctatga

DBGET integrated database retrieval system