Herbaspirillum seropedicae SmR1: Hsero_2339 Help Entry Hsero_2339        CDS       T01268                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism hse  Herbaspirillum seropedicae SmR1 Pathway hse00261   Monobactam biosynthesis hse01100   Metabolic pathways hse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hse00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Hsero_2339  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:hse01008]     Hsero_2339 Polyketide biosynthesis proteins [BR:hse01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Hsero_2339 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Top1B_N_bact Motif Other DBs NCBI-ProteinID:  ADJ63838 UniProt:  D8IV99 LinkDB All DBs Position 2648532..2648753 Genome browser AA seq 73 aa AA seqDB search MSFDADDAVFRVLVNHEEQYSIWPDYKAIPPGWTDVGVSGDKATCLAHVEKVWTDMRPLS LRRFMEQEQNAAG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagttttgatgctgacgatgcggtgttccgcgtactggtcaatcacgaagagcaatat tccatctggcccgactacaaggccattccgccgggctggaccgatgtgggcgtcagcggc gacaaagcgacttgcctggcgcatgtcgagaaggtctggaccgacatgcgcccgctgagc ctgcggcgcttcatggaacaggaacagaacgccgcgggctga

DBGET integrated database retrieval system