Vreelandella sulfidaeris: HSBAA_65740 Help Entry HSBAA_65740       CDS       T06264                                  Name (GenBank) hypothetical protein   KO K10806   acyl-CoA thioesterase YciA [EC:3.1.2.-] Organism hsr  Vreelandella sulfidaeris Pathway hsr01040   Biosynthesis of unsaturated fatty acids Brite KEGG Orthology (KO) [BR:hsr00001]  09100 Metabolism   09103 Lipid metabolism    01040 Biosynthesis of unsaturated fatty acids     HSBAA_65740  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:hsr01004]     HSBAA_65740 Lipid biosynthesis proteins [BR:hsr01004]  Fatty acid synthase   Component type    HSBAA_65740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  4HBT Motif Other DBs NCBI-ProteinID:  BBI65268 UniProt:  A0A455ULQ2 LinkDB All DBs Position complement(4121617..4121829) Genome browser AA seq 70 aa AA seqDB search MTLLETDLDDVPAPQGKLTLKLLASRQDTNLYGDIPGGWLVNQMDQAAELAAGREAGGRT ATVAIEAMDF NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgactcttctggaaaccgatttggacgacgtacccgcccctcaaggaaagcttacttta aaattactggcttctcgtcaagataccaatctttatggcgatattcccggggggtggctg gttaatcaaatggatcaggctgctgaattggcagctgggcgtgaagcgggtggccgtacg gccactgtagccattgaagccatggatttttaa

DBGET integrated database retrieval system