Helicobacter winghamensis: A0Z60_03540 Help Entry A0Z60_03540       CDS       T07030                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hwi  Helicobacter winghamensis Pathway hwi00020   Citrate cycle (TCA cycle) hwi01100   Metabolic pathways hwi01110   Biosynthesis of secondary metabolites hwi01120   Microbial metabolism in diverse environments hwi01200   Carbon metabolism hwi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hwi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A0Z60_03540 Enzymes [BR:hwi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A0Z60_03540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_2 Fer4_9 Fer4_6 Fer4_16 Fer4_8 Fer4_13 Fer4_4 Fer4_17 Fer4_3 SAM_Ste50p A-ATP_synth_H_N Fer4_15 Motif Other DBs NCBI-ProteinID:  QOQ98648 LinkDB All DBs Position complement(706790..707101) Genome browser AA seq 103 aa AA seqDB search MGLLKAPDNTPVWVNENRCKACDLCVSVCPSGTLAMRLDENRVLGKMVEIIHPESCIGCQ DCELHCPDFAISVADRKEFKFAKITDEAKQRAEAIKANHYMAV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggattattaaaagcccctgataatacacctgtttgggtgaatgagaatcgctgtaaa gcttgtgatttatgtgtatccgtatgtccttcagggacattggcaatgcgtcttgatgaa aatagagtcttgggaaaaatggtagagattattcatcctgaaagttgcattggttgtcaa gattgtgagttgcattgtccagattttgcaatttcagttgcagatagaaaagagtttaag tttgcaaagattactgatgaagcaaaacaaagagcagaagcaattaaagctaatcactat atggcagtataa

DBGET integrated database retrieval system