Hydrogenophaga sp. PBC: Q5W_00480 Help Entry Q5W_00480         CDS       T04491                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hyb  Hydrogenophaga sp. PBC Pathway hyb00790   Folate biosynthesis hyb01100   Metabolic pathways hyb01240   Biosynthesis of cofactors Module hyb_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hyb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Q5W_00480 Enzymes [BR:hyb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Q5W_00480  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Q5W_00480  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Q5W_00480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOS77558 LinkDB All DBs Position complement(96075..96449) Genome browser AA seq 124 aa AA seqDB search MIPTTAATQILTLSGLRFDANLGILDREKQAPQPIRVDAELNQGTQPLLPKDDDITHVLD YRKVRQIIIDECTAEHVNLLESLIGKLTRRLMQLPGVIGVRVKIAKLEIFEDCEVAIRME SGQW NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgatccccacgaccgccgccacccagatcctcaccctcagcgggctgcgcttcgacgcc aacctgggcatcctcgaccgcgagaagcaggcgccgcagcccatccgcgtcgacgccgaa ctcaaccagggcacgcagcccctgctgcccaaggacgacgacatcacccacgtgctcgac taccgcaaggtgcgccagatcatcatcgacgagtgcaccgccgagcacgtgaacctgctg gagagcctgatcggcaaactcacccgccggctcatgcagttgcccggcgtgatcggcgtg cgcgtgaagatcgccaagctggagatcttcgaggactgcgaggtcgcgatccgcatggaa agcgggcaatggtag

DBGET integrated database retrieval system