Hymenobacter sp. DG25B: PK28_14255 Help Entry PK28_14255        CDS       T03500                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hyd  Hymenobacter sp. DG25B Pathway hyd00790   Folate biosynthesis hyd01100   Metabolic pathways hyd01240   Biosynthesis of cofactors Module hyd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hyd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PK28_14255 Enzymes [BR:hyd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PK28_14255  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PK28_14255  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PK28_14255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIZ64546 UniProt:  A0A0A7LME6 LinkDB All DBs Position complement(3324761..3325129) Genome browser AA seq 122 aa AA seqDB search MGQIALEGMEFFAFHGYYDEEQKIGNKYGVDLYIKTDLYAAGTSDKLHETVNYEVLYRMV REEMQAPARLLEHLGHRVIDRVLEEFPHVLSVKVKVAKFNPPLGGICRRAQITLVRKRAG QR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggccagattgcactggaaggcatggagtttttcgcgtttcacggctactacgacgag gagcagaaaatcggcaataagtatggcgtagacctgtacataaagacggatctgtacgca gccggcacttcggataagctgcacgagacggtgaattacgaagtgctctaccggatggtg cgcgaggaaatgcaggcaccggcgcggctgctggagcacctgggccaccgcgttatagac cgggtgctggaagaattcccccacgtgctgtccgtgaaagtgaaggtggccaagtttaac ccgccgctgggcggtatctgccggcgcgcccagattacgttggtgcgcaagcgggccggg caacgctag

DBGET integrated database retrieval system