Hymenobacter sp. DG25A: AM218_02170 Help Entry AM218_02170       CDS       T04064                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism hye  Hymenobacter sp. DG25A Pathway hye00790   Folate biosynthesis hye01100   Metabolic pathways hye01240   Biosynthesis of cofactors Module hye_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:hye00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AM218_02170 Enzymes [BR:hye01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AM218_02170  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AM218_02170  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AM218_02170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ALD20254 UniProt:  A0A0M4HM29 LinkDB All DBs Position 502041..502409 Genome browser AA seq 122 aa AA seqDB search MGQIALEGMEFFAFHGYYDEEQKIGNKYGVDLYIRTDLYAAGTSDKLHETVNYEVLYRMV REEMQAPARLLEHLGHRVIDRVLEEFPHVLSVKVKVAKFNPPLGGICRRAQITLVRKRAG QR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggccagattgcactggaaggcatggagtttttcgcgtttcacggctactatgacgag gagcagaaaatcggcaataagtatggggtagacctgtacatccggacggatctgtacgcc gccggaacctcagataagctgcacgagacggtgaactacgaagtgctctaccgtatggtg cgtgaggaaatgcaggcgccagcgcggctgctggagcacctggggcaccgggtaatagac cgggtgctggaagagtttccccacgtgctgtccgtgaaagtgaaggtagccaagtttaac ccgccgctaggcggcatctgccggcgtgcccagattacgctggtgcgcaaacgggccggg caacgctag

DBGET integrated database retrieval system