Iamia sp. SCSIO 61187: HC251_20725 Help Entry HC251_20725       CDS       T07394                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism iam  Iamia sp. SCSIO 61187 Pathway iam00790   Folate biosynthesis iam01100   Metabolic pathways iam01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:iam00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HC251_20725 (folB) Enzymes [BR:iam01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HC251_20725 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HC251_20725 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HC251_20725 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QYG94622 LinkDB All DBs Position complement(4323572..4323955) Genome browser AA seq 127 aa AA seqDB search MPDGDLIELRGLTALGVCGALPEEQERAQPLEVDLAIHADLAAAGESDDLDDTVDYGAVC ELVERVVTTERFQLLERLAARIAEVVLSDDRVLGVTVAVRKLRPPVAQIVDTSGVRITRT RQGTTAG NT seq 384 nt NT seq  +upstreamnt  +downstreamnt gtgcctgacggcgacctgatcgagctgcgcggcctgaccgccctcggggtgtgcggagcc ctgcccgaggagcaggagcgggcccagcccctcgaggtcgacctcgccatccacgccgac ctggccgccgccggagagtccgacgacctcgacgacaccgtcgactacggcgccgtgtgc gagctggtggagcgggtcgtcacgaccgagcggttccagctcctggagcggctggcggcg cgcatcgccgaggtggtcctgtccgacgaccgggtcctcggcgtcaccgtcgccgtgcgc aagctgcggcccccggtggcccagatcgtggacacgtccggggtgcgcatcacgcgcacc cgccaggggaccaccgcagggtga

DBGET integrated database retrieval system