Ignicoccus islandicus: EYM_04810 Help Entry EYM_04810         CDS       T04205                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism iis  Ignicoccus islandicus Pathway iis00020   Citrate cycle (TCA cycle) iis00720   Carbon fixation pathways in prokaryotes iis01100   Metabolic pathways iis01110   Biosynthesis of secondary metabolites iis01120   Microbial metabolism in diverse environments iis01200   Carbon metabolism iis01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:iis00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     EYM_04810   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     EYM_04810 Enzymes [BR:iis01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      EYM_04810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_7 Fer4_6 Fer4_17 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_22 Fer4_3 Fer4_15 Fer4_13 DUF5651 Fer4_18 Motif Other DBs NCBI-ProteinID:  ALU11798 UniProt:  A0A0U3FIT1 LinkDB All DBs Position 843105..843353 Genome browser AA seq 82 aa AA seqDB search MVKWRIEIIEDFCKGCEICVNICPVTNLYKSGKVDKPVLRMSDRFGYQGYPVVEVVDPTK CTGCHLCDYSCPDLAIHVIKEE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtgaagtggaggattgaaatcatagaggatttctgcaaaggttgcgaaatatgcgtc aacatatgtcccgtgaccaacctatacaagagcggcaaagtggacaaaccagtactgcga atgagcgataggttcggatatcaaggatacccagtagtagaagtcgtggaccctacgaag tgcactggatgccacctttgcgattactcgtgtccagacctagctattcacgtaataaaa gaagagtaa

DBGET integrated database retrieval system