Ignicoccus pacificus: IPA_01110 Help Entry IPA_01110         CDS       T08506                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ipc  Ignicoccus pacificus Pathway ipc00020   Citrate cycle (TCA cycle) ipc00720   Carbon fixation pathways in prokaryotes ipc01100   Metabolic pathways ipc01110   Biosynthesis of secondary metabolites ipc01120   Microbial metabolism in diverse environments ipc01200   Carbon metabolism ipc01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ipc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     IPA_01110   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     IPA_01110 Enzymes [BR:ipc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      IPA_01110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_2 Fer4_10 Fer4_7 Fer4_9 Fer4_6 Fer4_16 Fer4_17 Fer4_4 Fer4_8 DUF5651 Fer4_3 Fer4_22 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  UXD21196 UniProt:  A0A977PJ25 LinkDB All DBs Position 189333..189581 Genome browser AA seq 82 aa AA seqDB search MVKWRIEIIEDFCKGCEICVNICPITNLYKVGKVDKPVLRMSERFGYQGYPLVEVVDPTK CTGCHLCDHACPDLAIHVIKEE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtgaagtggaggattgagataatagaggacttctgtaagggatgtgagatctgtgtc aacatatgtccgataaccaacctctacaaagtagggaaggtggacaagcctgtcttgagg atgagcgagaggttcggctaccaggggtatcccttagtggaggtcgtggatccgaccaag tgtactggctgtcacctctgcgatcacgcttgtccagacttggcgatccacgtcataaag gaggagtga

DBGET integrated database retrieval system