Janthinobacterium sp. B9-8: VN23_17095 Help Entry VN23_17095        CDS       T04271                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism jab  Janthinobacterium sp. B9-8 Pathway jab00261   Monobactam biosynthesis jab01100   Metabolic pathways jab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:jab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     VN23_17095  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:jab01008]     VN23_17095 Polyketide biosynthesis proteins [BR:jab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     VN23_17095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AMC36184 UniProt:  A0A0X8GRM0 LinkDB All DBs Position complement(3789230..3789430) Genome browser AA seq 66 aa AA seqDB search MSNEQVNPFDDESQDFLVLKNALGQYSLWPDFAAVPVGWSSVLGPEGHARCLEYIELNWL DIRVTQ NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaatgagcaggttaatccttttgatgatgagagccaggatttcctggtattgaaa aacgccttggggcaatacagcctgtggcctgattttgctgcggtgccagtaggctggagc tcggtattggggccagagggccatgcccgttgccttgaatatattgaattgaattggctt gatattcgcgttacccagtaa

DBGET integrated database retrieval system